This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
ERCC6L monoclonal antibody (M01), clone 3F12-2B10
catalog :
H00054821-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3F12-2B10
reactivity :
human
application :
western blot, ELISA
citations: 2
Reference
Kurasawa Y, Yu Lee L. PICH and cotargeted Plk1 coordinately maintain prometaphase chromosome arm architecture. Mol Biol Cell. 2010;21:1188-99 pubmed publisher
Leng M, Besusso D, Jung S, Wang Y, Qin J. Targeting Plk1 to chromosome arms and regulating chromosome compaction by the PICH ATPase. Cell Cycle. 2008;7:1480-9 pubmed
product information
catalog id :
H00054821-M01
product name :
ERCC6L monoclonal antibody (M01), clone 3F12-2B10
product description :
Mouse monoclonal antibody raised against a full length recombinant ERCC6L.
clone name :
3F12-2B10
isotype :
IgG2a kappa
gene name :
ERCC6L
gene alias :
FLJ20105 MGC131695 PICH
gene description :
excision repair cross-complementing rodent repair deficiency, complementation group 6-like
genbank accession :
BC008808
immunogen :
ERCC6L (AAH08808, 1 a.a. ~ 419 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MEKSFATKNEAVQKETLQEGPKQEALQEDPLESFNYVLS
KSTKADIGPNLDQLKDDEILRHCNPWPIISITNESQNAE
SNVSIIEIADDLSASHSALQDAQASEAKLEEEPSASSPQ
YACDFNLFLEDSADNRQNFSSQSLEHVEKENSLCGSAPN
SRAGFVHSKTCLSWEFSEKDDEPEEVVVKAKIRSKARRI
VSDGEDEDDSFKDTSSINPFNTSLFQFSSVKQFDASTPK
NDISPPGRFFSSQIPSSVNKSMNSRRSLASRRSLINMVL
DHVEDMEERLDDSSEAKGPEDYPEEGVEESSGEASKYTE
EDPSGETLSSENKSSWLMTSKPSALAQETSLGAPEPLSG
EQLVGSPQDKAAEATNDYETLVKRGKELKECGKIQEALN
CLVKALDIKSADPEVMLLTLSLYKQLNNN
protein accession :
AAH08808
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Tr,S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
10/10/06
updatetime :
11/15/13 18:29
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com
877-853-6098