This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
ERCC6L purified MaxPab mouse polyclonal antibody (B01P)
catalog :
H00054821-B01P
quantity :
50 ug
clonality :
polyclonal
host :
mouse
conjugate :
nonconjugated
reactivity :
human
application :
western blot
citations: 1
Reference
Tiwari A, Addis Jones O, Chan K. 53BP1 can limit sister-chromatid rupture and rearrangements driven by a distinct ultrafine DNA bridging-breakage process. Nat Commun. 2018;9:677 pubmed publisher
product information
catalog id :
H00054821-B01P
product name :
ERCC6L purified MaxPab mouse polyclonal antibody (B01P)
product description :
Mouse polyclonal antibody raised against a full-length human ERCC6L protein.
gene name :
ERCC6L
gene alias :
FLJ20105 MGC131695 PICH
gene description :
excision repair cross-complementing rodent repair deficiency, complementation group 6-like
genbank accession :
BC008808.2
immunogen :
ERCC6L (AAH08808.1, 1 a.a. ~ 419 a.a) full-length human protein.
immunogen sequence protein sequence :
MEKSFATKNEAVQKETLQEGPKQEALQEDPLESFNYVLS
KSTKADIGPNLDQLKDDEILRHCNPWPIISITNESQNAE
SNVSIIEIADDLSASHSALQDAQASEAKLEEEPSASSPQ
YACDFNLFLEDSADNRQNFSSQSLEHVEKENSLCGSAPN
SRAGFVHSKTCLSWEFSEKDDEPEEVVVKAKIRSKARRI
VSDGEDEDDSFKDTSSINPFNTSLFQFSSVKQFDASTPK
NDISPPGRFFSSQIPSSVNKSMNSRRSLASRRSLINMVL
DHVEDMEERLDDSSEAKGPEDYPEEGVEESSGEASKYTE
EDPSGETLSSENKSSWLMTSKPSALAQETSLGAPEPLSG
EQLVGSPQDKAAEATNDYETLVKRGKELKECGKIQEALN
CLVKALDIKSADPEVMLLTLSLYKQLNNN
protein accession :
AAH08808.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody reactive against mammalian transfected lysate.
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,WB-Tr
size :
50 ug
autodate :
2008-12-08
updatetime :
2013-11-15 18:41:54
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com
877-853-6098