This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
GHRL monoclonal antibody (M15), clone 2F2
catalog :
H00051738-M15
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2f2
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00051738-M15
product name :
GHRL monoclonal antibody (M15), clone 2F2
product description :
Mouse monoclonal antibody raised against a full length recombinant GHRL.
clone name :
2F2
isotype :
IgG2a Kappa
gene name :
GHRL
gene alias :
MTLRP obestatin
gene description :
ghrelin/obestatin prepropeptide
genbank accession :
NM_016362
immunogen :
GHRL (NP_057446, 24 a.a. ~ 117 a.a) full length recombinant protein.
immunogen sequence protein sequence :
GSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDG
GQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKF
LQDILWEEAKEAPADK
protein accession :
NP_057446
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2007-05-03
updatetime :
2017-09-05 15:48:47
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com
877-853-6098