This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
ANGPT4 monoclonal antibody (M01), clone 1B7
catalog :
H00051378-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1B7
reactivity :
human
application :
western blot, ELISA, immunohistochemistry - paraffin section
product information
catalog id :
H00051378-M01
product name :
ANGPT4 monoclonal antibody (M01), clone 1B7
product description :
Mouse monoclonal antibody raised against a partial recombinant ANGPT4.
clone name :
1B7
isotype :
IgG2b Kappa
gene name :
ANGPT4
gene alias :
AGP4 ANG-3 ANG4 MGC138181 MGC138183
gene description :
angiopoietin 4
genbank accession :
NM_015985
immunogen :
ANGPT4 (NP_057069, 25 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
TRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSR
DSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLK
KLERAIKTI
DSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLK
KLERAIKTI
protein accession :
NP_057069
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IHC-P,S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2009-07-06
updatetime :
2013-11-15 18:43:32
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
