This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
TAOK3 monoclonal antibody (M05), clone 1D8
catalog :
H00051347-M05
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1D8
reactivity :
human
application :
western blot, ELISA, immunocytochemistry
product information
catalog id :
H00051347-M05
product name :
TAOK3 monoclonal antibody (M05), clone 1D8
product description :
Mouse monoclonal antibody raised against a partial recombinant TAOK3.
clone name :
1D8
isotype :
IgG2a Kappa
gene name :
TAOK3
gene alias :
DKFZp666H245 DPK FLJ31808 JIK MAP3K18
gene description :
TAO kinase 3
genbank accession :
NM_016281
immunogen :
TAOK3 (NP_057365.2, 809 a.a. ~ 898 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
LNAYQSKIKMQTEAQHERELQKLEQRVSLRRAHLEQKIE
EELAALQKERSERIKNLLERQEREIETFDMESLRMGFGN
LVTLDFPKEDYR
EELAALQKERSERIKNLLERQEREIETFDMESLRMGFGN
LVTLDFPKEDYR
protein accession :
NP_057365.2
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IF,S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2007-11-09
updatetime :
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
