This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
TLR7 monoclonal antibody (M07), clone 4G6
catalog :
H00051284-M07
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4G6
The same clone is also sold as:
The same clone is also sold as:
- OriGene: TA337157
- Novus Biologicals: NBP2-27332, NBP2-80982, NBP2-25274
- Invitrogen: MA5-16249, MA5-16247
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00051284-M07
product name :
TLR7 monoclonal antibody (M07), clone 4G6
product description :
Mouse monoclonal antibody raised against a partial recombinant TLR7.
clone name :
4G6
isotype :
IgG2a Kappa
gene name :
TLR7
gene alias :
-
gene description :
toll-like receptor 7
genbank accession :
NM_016562
immunogen :
TLR7 (NP_057646, 27 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
ARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIPGGIPT
NTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPIP
LGSKNNMCIKRLQIKPRSFSGL
NTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPIP
LGSKNNMCIKRLQIKPRSFSGL
protein accession :
NP_057646
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2006-10-10
updatetime :
2013-11-15 18:29:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
