ABHD5 monoclonal antibody (M01), clone 1F3 | Abnova H00051099-M01 product information

product summary

company name :

Abnova

product type :

antibody

product name :

ABHD5 monoclonal antibody (M01), clone 1F3

catalog :

H00051099-M01

quantity :

100 ug

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

1F3

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section, western blot knockout validation

more info or order :

Abnova product webpage

citations: 15

Published Application/Species/Sample/Dilution	Reference
western blot knockout validation; human; loading ...; fig 4b	Yang P, Wang Y, Tang W, Sun W, Ma Y, Lin S, et al. Western diet induces severe nonalcoholic steatohepatitis, ductular reaction, and hepatic fibrosis in liver CGI-58 knockout mice. Sci Rep. 2020;10:4701 pubmed publisher
western blot knockout validation; human; fig 1k immunoprecipitation; human; fig 5b immunocytochemistry; human; fig 5a immunohistochemistry; human; loading ...; fig 8a	Peng Y, Miao H, Wu S, Yang W, Zhang Y, Xie G, et al. ABHD5 interacts with BECN1 to regulate autophagy and tumorigenesis of colon cancer independent of PNPLA2. Autophagy. 2016;12:2167-2182 pubmed
western blot; human; 1:250; loading ...; fig 1d	Hirschmugl B, Desoye G, Catalano P, Klymiuk I, Scharnagl H, Payr S, et al. Maternal obesity modulates intracellular lipid turnover in the human term placenta. Int J Obes (Lond). 2017;41:317-323 pubmed publisher
western blot; mouse; 1:1000; fig 1	Miao H, Ou J, Peng Y, Zhang X, Chen Y, Hao L, et al. Macrophage ABHD5 promotes colorectal cancer growth by suppressing spermidine production by SRM. Nat Commun. 2016;7:11716 pubmed publisher
immunocytochemistry; human; 1:1000; fig s3 western blot; human; 1:1000; fig 2	Vieyres G, Welsch K, Gerold G, Gentzsch J, Kahl S, Vondran F, et al. ABHD5/CGI-58, the Chanarin-Dorfman Syndrome Protein, Mobilises Lipid Stores for Hepatitis C Virus Production. PLoS Pathog. 2016;12:e1005568 pubmed publisher
immunoprecipitation; mouse; loading ...; fig 1e western blot; mouse; loading ...; fig 1e	Hofer P, Boeszoermenyi A, Jaeger D, Feiler U, Arthanari H, Mayer N, et al. Fatty Acid-binding Proteins Interact with Comparative Gene Identification-58 Linking Lipolysis with Lipid Ligand Shuttling. J Biol Chem. 2015;290:18438-53 pubmed publisher
western blot; mouse; fig 1d	Das S, Stadelmeyer E, Schauer S, Schwarz A, Strohmaier H, Claudel T, et al. Micro RNA-124a regulates lipolysis via adipose triglyceride lipase and comparative gene identification 58. Int J Mol Sci. 2015;16:8555-68 pubmed publisher
western blot; human	Bakke S, Feng Y, NikoliÄ‡ N, Kase E, Moro C, Stensrud C, et al. Myotubes from severely obese type 2 diabetic subjects accumulate less lipids and show higher lipolytic rate than myotubes from severely obese non-diabetic subjects. PLoS ONE. 2015;10:e0119556 pubmed publisher
western blot; human; 1:800	Kurtz C, Peck B, Fannin E, Beysen C, Miao J, Landstreet S, et al. MicroRNA-29 fine-tunes the expression of key FOXA2-activated lipid metabolism genes and is dysregulated in animal models of insulin resistance and diabetes. Diabetes. 2014;63:3141-8 pubmed publisher
	Camus G, Schweiger M, Herker E, Harris C, Kondratowicz A, Tsou C, et al. The hepatitis C virus core protein inhibits adipose triglyceride lipase (ATGL)-mediated lipid mobilization and enhances the ATGL interaction with comparative gene identification 58 (CGI-58) and lipid droplets. J Biol Chem. 2014;289:35770-80 pubmed publisher
	Guo F, Ma Y, Kadegowda A, Betters J, Xie P, Liu G, et al. Deficiency of liver Comparative Gene Identification-58 causes steatohepatitis and fibrosis in mice. J Lipid Res. 2013;54:2109-20 pubmed publisher
	Pollak N, Schweiger M, Jaeger D, Kolb D, Kumari M, Schreiber R, et al. Cardiac-specific overexpression of perilipin 5 provokes severe cardiac steatosis via the formation of a lipolytic barrier. J Lipid Res. 2013;54:1092-102 pubmed publisher
	Grall A, Guaguere E, Planchais S, Grond S, Bourrat E, Hausser I, et al. PNPLA1 mutations cause autosomal recessive congenital ichthyosis in golden retriever dogs and humans. Nat Genet. 2012;44:140-7 pubmed publisher
	Stenson B, Ryden M, Venteclef N, Dahlman I, Pettersson A, Mairal A, et al. Liver X receptor (LXR) regulates human adipocyte lipolysis. J Biol Chem. 2011;286:370-9 pubmed publisher
	Kinney B, Qiao L, Levaugh J, Shao J. B56alpha/protein phosphatase 2A inhibits adipose lipolysis in high-fat diet-induced obese mice. Endocrinology. 2010;151:3624-32 pubmed publisher

product information

catalog id :

H00051099-M01

product name :

ABHD5 monoclonal antibody (M01), clone 1F3

product description :

Mouse monoclonal antibody raised against a full length recombinant ABHD5.

clone name :

1F3

isotype :

IgG2a Kappa

gene name :

ABHD5

gene alias :

CDS CGI58 IECN2 MGC8731 NCIE2

gene description :

abhydrolase domain containing 5

genbank accession :

BC021958

immunogen :

ABHD5 (AAH21958, 1 a.a. ~ 349 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

immunogen sequence protein sequence :

MAAEEEEVDSADTGERSGWLTGWLPTWCPTSISHLKEAE
EKMLKCVPCTYKKEPVRISNGNKIWTLKFSHNISNKTPL
VLLHGFGGGLGLWALNFGDLCTNRPVYAFDLLGFGRSSR
PRFDSDAEEVENQFVESIEEWRCALGLDKMILLGHNLGG
FLAAAYSLKYPSRVNHLILVEPWGFPERPDLADQDRPIP
VWIRALGAALTPFNPLAGLRIAGPFGLSLVQRLRPDFKR
KYSSMFEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWA
KRPMLQRIGKMHPDIPVSVIFGARSCIDGNSGTSIQSLR
PHSYVKTIAILGAGHYVYADQPEEFNQKVKEICDTVD

protein accession :

AAH21958

storage buffer :

In 1x PBS, pH 7.4

storage instruction :

Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing

quality control testing :

Antibody Reactive Against Recombinant Protein

type clonality :

Antibody

raised in host species :

Mouse

antigen species target species :

Human

species reactivity cross reactivity :

Human,Rat

application key :

WB-Ti,WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IHC-P

size :

100 ug

autodate :

11/3/06

updatetime :

11/15/13 18:37

more info or order :

Abnova product webpage