This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
GAL monoclonal antibody (M01A), clone 3C1-G5
catalog :
H00051083-M01A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3C1-G5
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00051083-M01A
product name :
GAL monoclonal antibody (M01A), clone 3C1-G5
product description :
Mouse monoclonal antibody raised against a full-length recombinant GAL.
clone name :
3C1-G5
isotype :
IgG2b Kappa
gene name :
GAL
gene alias :
GALN GLNN GMAP MGC40167
gene description :
galanin prepropeptide
genbank accession :
BC030241
immunogen :
GAL (AAH30241, 1 a.a. ~ 123 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSA
GYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFD
RSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASS
EDIERS
GYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFD
RSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASS
EDIERS
protein accession :
AAH30241
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Tr,ELISA,WB-Re
size :
200 uL
autodate :
1/19/09
updatetime :
1/13/12 16:44
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
