This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SH3KBP1 monoclonal antibody (M01), clone 1F11
catalog :
H00030011-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1F11
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00030011-M01
product name :
SH3KBP1 monoclonal antibody (M01), clone 1F11
product description :
Mouse monoclonal antibody raised against a partial recombinant SH3KBP1.
clone name :
1F11
isotype :
IgG2a Kappa
gene name :
SH3KBP1
gene alias :
CIN85 GIG10 MIG18
gene description :
SH3-domain kinase binding protein 1
genbank accession :
NM_031892
immunogen :
SH3KBP1 (NP_114098.1, 224 a.a. ~ 308 a.a) partial recombinant protein with GST-pstS1 tag.
immunogen sequence protein sequence :
IKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKTEM
DSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDC
IDVGWWE
DSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDC
IDVGWWE
protein accession :
NP_114098.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,ELISA,WB-Re
size :
100 ug
autodate :
2013-12-06
updatetime :
2017-09-05 15:48:47
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
