This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
HIPK2 monoclonal antibody (M03), clone 1F10
catalog :
H00028996-M03
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1F10
reactivity :
human, rat
application :
western blot, ELISA, immunohistochemistry - paraffin section
product information
catalog id :
H00028996-M03
product name :
HIPK2 monoclonal antibody (M03), clone 1F10
product description :
Mouse monoclonal antibody raised against a partial recombinant HIPK2.
clone name :
1F10
isotype :
IgG2a Kappa
gene name :
HIPK2
gene alias :
DKFZp686K02111 FLJ23711 PRO0593
gene description :
homeodomain interacting protein kinase 2
genbank accession :
AF208291
immunogen :
HIPK2 (AAG41236.1, 961 a.a. ~ 1065 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHSSSYK
SKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPL
NLSQAQQHITTDRTGSHRRQQAYITPT
SKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPL
NLSQAQQHITTDRTGSHRRQQAYITPT
protein accession :
AAG41236.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Rat
application key :
S-ELISA,ELISA,WB-Ce,IHC-P
size :
100 ug
autodate :
9/6/07
updatetime :
11/15/13 18:37
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
