This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
REM1 monoclonal antibody (M02), clone 3A9
catalog :
H00028954-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3A9
reactivity :
human
product information
catalog id :
H00028954-M02
product name :
REM1 monoclonal antibody (M02), clone 3A9
product description :
Mouse monoclonal antibody raised against a partial recombinant REM1.
clone name :
3A9
isotype :
IgG2a Kappa
gene name :
REM1
gene alias :
GD:REM GES MGC48669 REM
gene description :
RAS (RAD and GEM)-like GTP-binding 1
genbank accession :
NM_014012
immunogen :
REM1 (NP_054731, 162 a.a. ~ 251 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
SIADRGSFESASELRIQLRRTHQADHVPIILVGNKADLA
RCREVSVEEGRACAVVFDCKFIETSATLQHNVAELFEGV
VRQLRLRRRDSA
RCREVSVEEGRACAVVFDCKFIETSATLQHNVAELFEGV
VRQLRLRRRDSA
protein accession :
NP_054731
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA
size :
100 ug
autodate :
2007-11-16
updatetime :
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
