This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
RPS6KA6 monoclonal antibody (M06A), clone 3G12
catalog :
H00027330-M06A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3G12
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00027330-M06A
product name :
RPS6KA6 monoclonal antibody (M06A), clone 3G12
product description :
Mouse monoclonal antibody raised against a partial recombinant RPS6KA6.
clone name :
3G12
isotype :
IgG2a Kappa
gene name :
RPS6KA6
gene alias :
RSK4
gene description :
ribosomal protein S6 kinase, 90kDa, polypeptide 6
genbank accession :
NM_014496
immunogen :
RPS6KA6 (NP_055311.1, 636 a.a. ~ 745 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
RIGNGKFSLSGGNWDNISDGAKDLLSHMLHMDPHQRYTA
EQILKHSWITHRDQLPNDQPKRNDVSHVVKGAMVATYSA
LTHKTFQPVLEPVAASSLAQRRSMKKRTSTGL
EQILKHSWITHRDQLPNDQPKRNDVSHVVKGAMVATYSA
LTHKTFQPVLEPVAASSLAQRRSMKKRTSTGL
protein accession :
NP_055311.1
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
200 uL
autodate :
2009-01-19
updatetime :
2012-01-13 16:44:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
