This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
EIF2C2 monoclonal antibody (M02), clone 4D1-1D1
catalog :
H00027161-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4D1-1D1
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00027161-M02
product name :
EIF2C2 monoclonal antibody (M02), clone 4D1-1D1
product description :
Mouse monoclonal antibody raised against a full-length recombinant EIF2C2.
clone name :
4D1-1D1
isotype :
IgG1 Kappa
gene name :
EIF2C2
gene alias :
AGO2 MGC3183 Q10
gene description :
eukaryotic translation initiation factor 2C, 2
genbank accession :
BC007633.1
immunogen :
EIF2C2 (AAH07633.1, 483 a.a. ~ 859 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVI
LPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTL
SNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVT
HPPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEI
IQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQ
QVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLF
CTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAG
IQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCT
RSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSGQ
SNGRDHQALAKAVQVHQDTLRTMYFA
LPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTL
SNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVT
HPPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEI
IQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQ
QVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLF
CTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAG
IQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCT
RSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSGQ
SNGRDHQALAKAVQVHQDTLRTMYFA
protein accession :
AAH07633.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
8/14/08
updatetime :
1/21/20 11:51
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
