EIF2C2 monoclonal antibody (M01), clone 2E12-1C9 | Abnova H00027161-M01 product information

product summary

company name :

Abnova

product type :

antibody

product name :

EIF2C2 monoclonal antibody (M01), clone 2E12-1C9

catalog :

H00027161-M01

quantity :

100 ug

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

2E12-1C9

reactivity :

human, mouse

application :

western blot, ELISA, immunocytochemistry, immunoprecipitation, chromatin immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Abnova product webpage

citations: 36

Published Application/Species/Sample/Dilution	Reference
western blot; human; loading ...; fig s3a	Xiao R, Chen J, Liang Z, Luo D, Chen G, Lu Z, et al. Pervasive Chromatin-RNA Binding Protein Interactions Enable RNA-Based Regulation of Transcription. Cell. 2019;178:107-121.e18 pubmed publisher
immunocytochemistry; human; loading ...; fig 1c western blot; human; loading ...; fig s12b	Huang J, Ku W, Chen Y, Chang Y, Chu C. Dual mechanisms regulate the nucleocytoplasmic localization of human DDX6. Sci Rep. 2017;7:42853 pubmed publisher
chromatin immunoprecipitation; human; fig s1	Slezak Prochazka I, Kluiver J, de Jong D, Smigielska Czepiel K, Kortman G, Winkle M, et al. Inhibition of the miR-155 target NIAM phenocopies the growth promoting effect of miR-155 in B-cell lymphoma. Oncotarget. 2016;7:2391-400 pubmed publisher
immunoprecipitation; mouse	Le Guillou S, Marthey S, Laloé D, Laubier J, Mobuchon L, Leroux C, et al. Characterisation and comparison of lactating mouse and bovine mammary gland miRNomes. PLoS ONE. 2014;9:e91938 pubmed publisher
	Mendonsa S, von K xfc gelgen N, Dantsuji S, Ron M, Breimann L, Baranovskii A, et al. Massively parallel identification of mRNA localization elements in primary cortical neurons. Nat Neurosci. 2023;26:394-405 pubmed publisher
	Li H, Zhan J, Zhao Y, Fan J, Yuan S, Yin Z, et al. Identification of ncRNA-Mediated Functions of Nucleus-Localized miR-320 in Cardiomyocytes. Mol Ther Nucleic Acids. 2019;19:132-143 pubmed publisher
	Curtale G, Renzi T, Mirolo M, Drufuca L, Albanese M, De Luca M, et al. Multi-Step Regulation of the TLR4 Pathway by the miR-125a~99b~let-7e Cluster. Front Immunol. 2018;9:2037 pubmed publisher
	Han H, Choi B, Kim J, Kang G, Koo S. Hepatic Crtc2 controls whole body energy metabolism via a miR-34a-Fgf21 axis. Nat Commun. 2017;8:1878 pubmed publisher
	Llobet Navas D, Rodríguez Barrueco R, de la Iglesia Vicente J, Olivan M, Castro V, Saucedo Cuevas L, et al. The microRNA 424/503 cluster reduces CDC25A expression during cell cycle arrest imposed by transforming growth factor Î² in mammary epithelial cells. Mol Cell Biol. 2014;34:4216-31 pubmed publisher
	Pai B, Siripornmongcolchai T, Berentsen B, Pakzad A, Vieuille C, Pallesen S, et al. NMDA receptor-dependent regulation of miRNA expression and association with Argonaute during LTP in vivo. Front Cell Neurosci. 2014;7:285 pubmed publisher
	Wei N, Zhang L, Huang H, Chen Y, Zheng J, Zhou X, et al. siRNA has greatly elevated mismatch tolerance at 3'-UTR sites. PLoS ONE. 2012;7:e49309 pubmed publisher
	Nazari Jahantigh M, Wei Y, Noels H, Akhtar S, Zhou Z, Koenen R, et al. MicroRNA-155 promotes atherosclerosis by repressing Bcl6 in macrophages. J Clin Invest. 2012;122:4190-202 pubmed publisher
	Tiedje C, Ronkina N, Tehrani M, Dhamija S, Laass K, Holtmann H, et al. The p38/MK2-driven exchange between tristetraprolin and HuR regulates AU-rich element-dependent translation. PLoS Genet. 2012;8:e1002977 pubmed publisher
	Reed J, Molter B, Geary C, McNevin J, McElrath J, Giri S, et al. HIV-1 Gag co-opts a cellular complex containing DDX6, a helicase that facilitates capsid assembly. J Cell Biol. 2012;198:439-56 pubmed publisher
	Kluiver J, Slezak Prochazka I, Smigielska Czepiel K, Halsema N, Kroesen B, van den Berg A. Generation of miRNA sponge constructs. Methods. 2012;58:113-7 pubmed publisher
	Dolezalova D, Mraz M, Bárta T, Plevova K, Vinarsky V, Holubcová Z, et al. MicroRNAs regulate p21(Waf1/Cip1) protein expression and the DNA damage response in human embryonic stem cells. Stem Cells. 2012;30:1362-72 pubmed publisher
	Bañez Coronel M, Porta S, Kagerbauer B, Mateu Huertas E, Pantano L, Ferrer I, et al. A pathogenic mechanism in Huntington's disease involves small CAG-repeated RNAs with neurotoxic activity. PLoS Genet. 2012;8:e1002481 pubmed publisher
	He M, Liu Y, Wang X, Zhang M, Hannon G, Huang Z. Cell-type-based analysis of microRNA profiles in the mouse brain. Neuron. 2012;73:35-48 pubmed publisher
	Chiang K, Sung T, Rice A. Regulation of cyclin T1 and HIV-1 Replication by microRNAs in resting CD4+ T lymphocytes. J Virol. 2012;86:3244-52 pubmed publisher
	Martinez Sanchez A, Dudek K, Murphy C. Regulation of human chondrocyte function through direct inhibition of cartilage master regulator SOX9 by microRNA-145 (miRNA-145). J Biol Chem. 2012;287:916-24 pubmed publisher
	Cook D, Sánchez Carbente M, Lachance C, Radzioch D, Tremblay S, Khandjian E, et al. Fragile X related protein 1 clusters with ribosomes and messenger RNAs at a subset of dendritic spines in the mouse hippocampus. PLoS ONE. 2011;6:e26120 pubmed publisher
	Turchinovich A, Weiz L, Langheinz A, Burwinkel B. Characterization of extracellular circulating microRNA. Nucleic Acids Res. 2011;39:7223-33 pubmed publisher
	Lund E, Sheets M, Imboden S, Dahlberg J. Limiting Ago protein restricts RNAi and microRNA biogenesis during early development in Xenopus laevis. Genes Dev. 2011;25:1121-31 pubmed publisher
	Glorian V, Maillot G, Polès S, Iacovoni J, Favre G, Vagner S. HuR-dependent loading of miRNA RISC to the mRNA encoding the Ras-related small GTPase RhoB controls its translation during UV-induced apoptosis. Cell Death Differ. 2011;18:1692-701 pubmed publisher
	Rawlings R, Krishnan V, Walter N. Viral RNAi suppressor reversibly binds siRNA to outcompete Dicer and RISC via multiple turnover. J Mol Biol. 2011;408:262-76 pubmed publisher
	Wang Y, Lacroix G, Haines J, Doukhanine E, Almazan G, Richard S. The QKI-6 RNA binding protein localizes with the MBP mRNAs in stress granules of glial cells. PLoS ONE. 2010;5: pubmed publisher
	Cheloufi S, Dos Santos C, Chong M, Hannon G. A dicer-independent miRNA biogenesis pathway that requires Ago catalysis. Nature. 2010;465:584-9 pubmed publisher
	Flemr M, Ma J, Schultz R, Svoboda P. P-body loss is concomitant with formation of a messenger RNA storage domain in mouse oocytes. Biol Reprod. 2010;82:1008-17 pubmed publisher
	Lin J, Tarn W. RNA-binding motif protein 4 translocates to cytoplasmic granules and suppresses translation via argonaute2 during muscle cell differentiation. J Biol Chem. 2009;284:34658-65 pubmed publisher
	Tan L, Seinen E, Duns G, de Jong D, Sibon O, Poppema S, et al. A high throughput experimental approach to identify miRNA targets in human cells. Nucleic Acids Res. 2009;37:e137 pubmed publisher
	Landry P, Plante I, Ouellet D, Perron M, Rousseau G, Provost P. Existence of a microRNA pathway in anucleate platelets. Nat Struct Mol Biol. 2009;16:961-6 pubmed publisher
	Zeitelhofer M, Karra D, Macchi P, Tolino M, Thomas S, Schwarz M, et al. Dynamic interaction between P-bodies and transport ribonucleoprotein particles in dendrites of mature hippocampal neurons. J Neurosci. 2008;28:7555-62 pubmed publisher
	Zeng Y, Sankala H, Zhang X, Graves P. Phosphorylation of Argonaute 2 at serine-387 facilitates its localization to processing bodies. Biochem J. 2008;413:429-36 pubmed publisher
	Alisch R, Jin P, Epstein M, Caspary T, Warren S. Argonaute2 is essential for mammalian gastrulation and proper mesoderm formation. PLoS Genet. 2007;3:e227 pubmed publisher
	Vickers T, Lima W, Nichols J, Crooke S. Reduced levels of Ago2 expression result in increased siRNA competition in mammalian cells. Nucleic Acids Res. 2007;35:6598-610 pubmed
	Krol J, Fiszer A, Mykowska A, Sobczak K, de Mezer M, Krzyzosiak W. Ribonuclease dicer cleaves triplet repeat hairpins into shorter repeats that silence specific targets. Mol Cell. 2007;25:575-86 pubmed

product information

catalog id :

H00027161-M01

product name :

EIF2C2 monoclonal antibody (M01), clone 2E12-1C9

product description :

Mouse monoclonal antibody raised against a full length recombinant EIF2C2.

clone name :

2E12-1C9

isotype :

IgG1 Kappa

gene name :

EIF2C2

gene alias :

AGO2 MGC3183 Q10

gene description :

eukaryotic translation initiation factor 2C, 2

genbank accession :

BC007633.1

immunogen :

EIF2C2 (AAH07633.1, 483 a.a. ~ 859 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

immunogen sequence protein sequence :

MPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVI
LPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTL
SNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVT
HPPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEI
IQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQ
QVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLF
CTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAG
IQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCT
RSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSGQ
SNGRDHQALAKAVQVHQDTLRTMYFA

protein accession :

AAH07633.1

storage buffer :

In 1x PBS, pH 7.4

storage instruction :

Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing

quality control testing :

Antibody Reactive Against Recombinant Protein

type clonality :

Antibody

raised in host species :

Mouse

antigen species target species :

Human

species reactivity cross reactivity :

Human

application key :

WB-Ce,WB-Tr,S-ELISA,RNAi-Ab,ELISA,WB-Re,IF,IHC-P

size :

100 ug

autodate :

12/4/07

updatetime :

1/21/20 11:48

more info or order :

Abnova product webpage