This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CACYBP monoclonal antibody (M01C), clone 2E3
catalog :
H00027101-M01C
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2E3
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00027101-M01C
product name :
CACYBP monoclonal antibody (M01C), clone 2E3
product description :
Mouse monoclonal antibody raised against a full-length recombinant CACYBP.
clone name :
2E3
isotype :
IgG1 Kappa
gene name :
CACYBP
gene alias :
GIG5 MGC87971 PNAS-107 RP1-102G20.6 S100A6BP SIP
gene description :
calcyclin binding protein
genbank accession :
BC005975
immunogen :
CACYBP (AAH05975, 1 a.a. ~ 228 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETE
IKNKMQQKSQKKAELLDNEKPAAVVAPITTGYTVKISNY
GWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLLV
KNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRK
KVENTRWDYLTQVEKECKEKEKPSYDTETDPSEGLMNVL
KKIYEDGDDDMKRTINKAWVESREKQAKGDTEF
IKNKMQQKSQKKAELLDNEKPAAVVAPITTGYTVKISNY
GWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLLV
KNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRK
KVENTRWDYLTQVEKECKEKEKPSYDTETDPSEGLMNVL
KKIYEDGDDDMKRTINKAWVESREKQAKGDTEF
protein accession :
AAH05975
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
200 uL
autodate :
2013-12-06
updatetime :
2013-12-06 16:20:27
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
