product summary
Loading...
company name :
Abnova
product type :
antibody
product name :
ATP2C1 monoclonal antibody (M01), clone 2G1
catalog :
H00027032-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2G1
reactivity :
human
application :
western blot, ELISA, immunocytochemistry, immunoprecipitation
more info or order :
citations: 3
| Published Application/Species/Sample/Dilution | Reference |
|---|---|
| |
Grice D, Vetter I, Faddy H, Kenny P, Roberts Thomson S, Monteith G. Golgi calcium pump secretory pathway calcium ATPase 1 (SPCA1) is a key regulator of insulin-like growth factor receptor (IGF1R) processing in the basal-like breast cancer cell line MDA-MB-231. J Biol Chem. 2010;285:37458-66 pubmed publisher
|
product information
catalog id :
H00027032-M01
product name :
ATP2C1 monoclonal antibody (M01), clone 2G1
product description :
Mouse monoclonal antibody raised against a partial recombinant ATP2C1.
clone name :
2G1
isotype :
IgG1 lambda
gene name :
ATP2C1
gene alias :
ATP2C1A BCPM HHD KIAA1347 PMR1 SPCA1 hSPCA1
gene description :
ATPase, Ca++ transporting, type 2C, member 1
genbank accession :
BC028139
immunogen :
ATP2C1 (AAH28139, 119 a.a. ~ 269 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
VQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVP
GDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCS
KVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGT
GENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQL
GDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCS
KVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGT
GENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQL
protein accession :
AAH28139
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab
size :
100 ug
autodate :
2006-10-10
updatetime :
2013-11-15 18:29:55
more info or order :
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
related products
browse more products
- ZBTB32 MaxPab mouse polyclonal antibody (B01) | H00027033-B01
- ZBTB32 purified MaxPab mouse polyclonal antibody (B01P) | H00027033-B01P
- ZBTB32 purified MaxPab mouse polyclonal antibody (B02P) | H00027033-B02P
- ACAD8 polyclonal antibody (A01) | H00027034-A01
- ACAD8 purified MaxPab mouse polyclonal antibody (B01P) | H00027034-B01P
questions and comments
