This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
FGF21 monoclonal antibody (M02), clone 1A8
catalog :
H00026291-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1A8
reactivity :
human
application :
western blot, ELISA, immunoprecipitation
product information
catalog id :
H00026291-M02
product name :
FGF21 monoclonal antibody (M02), clone 1A8
product description :
Mouse monoclonal antibody raised against a full length recombinant FGF21.
clone name :
1A8
isotype :
IgG1 Kappa
gene name :
FGF21
gene alias :
-
gene description :
fibroblast growth factor 21
genbank accession :
BC018404
immunogen :
FGF21 (AAH18404, 30 a.a. ~ 209 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGT
VGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPD
GALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHL
PGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQP
PDVGSSDPLSMVGPSQGRSPSYAS
VGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPD
GALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHL
PGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQP
PDVGSSDPLSMVGPSQGRSPSYAS
protein accession :
AAH18404
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Tr,IP,S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
4/18/08
updatetime :
11/15/13 18:40
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
