This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CLEC4E monoclonal antibody (M08), clone 2D12
catalog :
H00026253-M08
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2D12
reactivity :
human
application :
western blot, ELISA
citations: 2
| Reference |
|---|
product information
catalog id :
H00026253-M08
product name :
CLEC4E monoclonal antibody (M08), clone 2D12
product description :
Mouse monoclonal antibody raised against a full length recombinant CLEC4E.
clone name :
2D12
isotype :
IgG2a Kappa
gene name :
CLEC4E
gene alias :
CLECSF9 MINCLE
gene description :
C-type lectin domain family 4, member E
genbank accession :
BC000715
immunogen :
CLEC4E (AAH00715, 1 a.a. ~ 219 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFI
TRCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKN
CCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVV
INSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGT
PLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDV
TCFLNYFRICEMVGINPLNKGKSL
TRCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKN
CCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVV
INSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGT
PLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDV
TCFLNYFRICEMVGINPLNKGKSL
protein accession :
AAH00715
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2006-10-10
updatetime :
2013-11-15 18:29:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
