This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
HEY1 monoclonal antibody (M04), clone 3B2
catalog :
H00023462-M04
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3B2
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00023462-M04
product name :
HEY1 monoclonal antibody (M04), clone 3B2
product description :
Mouse monoclonal antibody raised against a partial recombinant HEY1.
clone name :
3B2
isotype :
IgG2a Kappa
gene name :
HEY1
gene alias :
BHLHb31 CHF2 HERP2 HESR1 HRT-1 MGC1274 OAF1
gene description :
hairy/enhancer-of-split related with YRPW motif 1
genbank accession :
NM_012258
immunogen :
HEY1 (NP_036390, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLN
NYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQ
NGHGNAGTTASPTEPHHQGRLG
protein accession :
NP_036390
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2007-09-06
updatetime :
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com
877-853-6098