This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SIRT1 monoclonal antibody (M01), clone 7B7
catalog :
H00023411-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
reactivity :
human
application :
western blot, ELISA, immunocytochemistry, immunohistochemistry - paraffin section
citations: 2
| Reference |
|---|
product information
catalog id :
H00023411-M01
product name :
SIRT1 monoclonal antibody (M01), clone 7B7
product description :
Mouse monoclonal antibody raised against a partial recombinant SIRT1.
clone name :
7B7
isotype :
IgG1 Kappa
gene name :
SIRT1
gene alias :
SIR2L1
gene description :
sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae)
genbank accession :
BC012499
immunogen :
SIRT1 (AAH12499, 456 a.a. ~ 555 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
NRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLE
EPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQE
AINEAISVKQEVTDMNYPSNKS
EPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQE
AINEAISVKQEVTDMNYPSNKS
protein accession :
AAH12499
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2006-10-10
updatetime :
2013-11-15 18:29:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
