This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
DDX20 monoclonal antibody (M01), clone 5H5
catalog :
H00011218-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
5H5
reactivity :
human
application :
immunocytochemistry
product information
catalog id :
H00011218-M01
product name :
DDX20 monoclonal antibody (M01), clone 5H5
product description :
Mouse monoclonal antibody raised against a partial recombinant DDX20.
clone name :
5H5
isotype :
IgG2a Kappa
gene name :
DDX20
gene alias :
DKFZp434H052 DP103 GEMIN3
gene description :
DEAD (Asp-Glu-Ala-Asp) box polypeptide 20
genbank accession :
NM_007204
immunogen :
DDX20 (NP_009135, 725 a.a. ~ 824 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
EGASQRAKQSRRNLPRRSSFRLQTEAQEDDWYDCHREIR
LSFSDTYQDYEEYWRAYYRAWQEYYAAASHSYYWNAQRH
PSWMAAYHMNTIYLQEMMHSNQ
LSFSDTYQDYEEYWRAYYRAWQEYYAAASHSYYWNAQRH
PSWMAAYHMNTIYLQEMMHSNQ
protein accession :
NP_009135
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IF,S-ELISA,ELISA
size :
100 ug
autodate :
2006-11-16
updatetime :
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
