This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
NUDT21 monoclonal antibody (M01), clone 2G4-6F11
catalog :
H00011051-M01C
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2G4-6F11
reactivity :
human
product information
catalog id :
H00011051-M01C
product name :
NUDT21 monoclonal antibody (M01), clone 2G4-6F11
product description :
Mouse monoclonal antibody raised against a full-length recombinant NUDT21.
clone name :
2G4-6F11
isotype :
IgG1 Kappa
gene name :
NUDT21
gene alias :
CFIM25 CPSF5 DKFZp686H1588
gene description :
nudix (nucleoside diphosphate linked moiety X)-type motif 21
genbank accession :
BC001403
immunogen :
NUDT21 (AAH01403, 1 a.a. ~ 227 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINL
YPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRR
TVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDE
VEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPP
QYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVA
APLFELYDNAPGYGPIISSLPQLLSRFNFIYN
YPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRR
TVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDE
VEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPP
QYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVA
APLFELYDNAPGYGPIISSLPQLLSRFNFIYN
protein accession :
AAH01403
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA
size :
200 uL
autodate :
2009-03-30
updatetime :
2012-01-13 16:44:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
