This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
PPARGC1A monoclonal antibody (M01J), clone 4A8
catalog :
H00010891-M01J
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00010891-M01J
product name :
PPARGC1A monoclonal antibody (M01J), clone 4A8
product description :
Mouse monoclonal antibody raised against a partial recombinant PPARGC1A.
clone name :
4A8
isotype :
IgG2b Kappa
gene name :
PPARGC1A
gene alias :
LEM6 PGC-1(alpha) PGC-1v PGC1 PGC1A PPARGC1
gene description :
peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
genbank accession :
NM_013261
immunogen :
PPARGC1A (NP_037393, 689 a.a. ~ 798 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCD
AFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDS
NSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR
AFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDS
NSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR
protein accession :
NP_037393
preparation method :
Cell Culture Production. (CX Grade Antibody List)
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,S-ELISA,WB-Re,ELISA
size :
100 ug
autodate :
1/15/19
updatetime :
12/12/19 14:00
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
