FGL2 monoclonal antibody (M01), clone 6D9 | Abnova H00010875-M01 product information

product summary

company name :

Abnova

product type :

antibody

product name :

FGL2 monoclonal antibody (M01), clone 6D9

catalog :

H00010875-M01

quantity :

100 ug

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

6D9

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunoprecipitation, flow cytometry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section, western blot knockout validation

more info or order :

Abnova product webpage

citations: 6

Published Application/Species/Sample/Dilution	Reference
western blot knockout validation; mouse; 1:1000; loading ...; fig s1c immunohistochemistry - paraffin section; mouse; 1:100; loading ...; fig s2b flow cytometry; mouse; loading ...; fig s2e immunohistochemistry - paraffin section; human; 1:100; loading ...; fig s2a western blot; human; 1:1000; loading ...; fig 8c	Hu J, Wang H, Li X, Liu Y, Mi Y, Kong H, et al. Fibrinogen-like protein 2 aggravates nonalcoholic steatohepatitis via interaction with TLR4, eliciting inflammation in macrophages and inducing hepatic lipid metabolism disorder. Theranostics. 2020;10:9702-9720 pubmed publisher
immunohistochemistry - frozen section; mouse; 1:100; loading ...; fig 1d western blot; mouse; 1:1000; loading ...; fig 1a	Zhu Y, Zhou J, Feng Y, Chen L, Zhang L, Yang F, et al. Control of Intestinal Inflammation, Colitis-Associated Tumorigenesis, and Macrophage Polarization by Fibrinogen-Like Protein 2. Front Immunol. 2018;9:87 pubmed publisher
	Selzner N, Liu H, Boehnert M, Adeyi O, Shalev I, Bartczak A, et al. FGL2/fibroleukin mediates hepatic reperfusion injury by induction of sinusoidal endothelial cell and hepatocyte apoptosis in mice. J Hepatol. 2012;56:153-9 pubmed publisher
	Liu Y, Xu S, Xiao F, Xiong Y, Wang X, Gao S, et al. The FGL2/fibroleukin prothrombinase is involved in alveolar macrophage activation in COPD through the MAPK pathway. Biochem Biophys Res Commun. 2010;396:555-61 pubmed publisher
	Shalev I, Liu H, Koscik C, Bartczak A, Javadi M, Wong K, et al. Targeted deletion of fgl2 leads to impaired regulatory T cell activity and development of autoimmune glomerulonephritis. J Immunol. 2008;180:249-60 pubmed
	O Brien M, Morrison J, Smith T. Expression of prothrombin and protease activated receptors in human myometrium during pregnancy and labor. Biol Reprod. 2008;78:20-6 pubmed

product information

catalog id :

H00010875-M01

product name :

FGL2 monoclonal antibody (M01), clone 6D9

product description :

Mouse monoclonal antibody raised against a partial recombinant FGL2.

clone name :

6D9

isotype :

IgG2a Kappa

gene name :

FGL2

gene alias :

T49 pT49

gene description :

fibrinogen-like 2

genbank accession :

NM_006682

immunogen :

FGL2 (NP_006673, 24 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

immunogen sequence protein sequence :

NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLP
PLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKL
QADDNGDPGRNGLLLPSTGAPG

protein accession :

NP_006673

storage buffer :

In 1x PBS, pH 7.4

storage instruction :

Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing

quality control testing :

Antibody Reactive Against Recombinant Protein

type clonality :

Antibody

raised in host species :

Mouse

antigen species target species :

Human

species reactivity cross reactivity :

Human,Mouse,Rat

application key :

IP,S-ELISA,ELISA,WB-Re,WB-Tr,WB-Ce,IHC-P

size :

100 ug

autodate :

10/10/06

updatetime :

11/15/13 18:29

more info or order :

Abnova product webpage