This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CSPG5 monoclonal antibody (M01), clone 5C11
catalog :
H00010675-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
5C11
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00010675-M01
product name :
CSPG5 monoclonal antibody (M01), clone 5C11
product description :
Mouse monoclonal antibody raised against a partial recombinant CSPG5.
clone name :
5C11
isotype :
IgG1 Kappa
gene name :
CSPG5
gene alias :
MGC44034 NGC
gene description :
chondroitin sulfate proteoglycan 5 (neuroglycan C)
genbank accession :
NM_006574
immunogen :
CSPG5 (NP_006565, 445 a.a. ~ 539 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
KKLYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIAEGS
HPNDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGG
KGDQADLDVNCLQNNLT
HPNDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGG
KGDQADLDVNCLQNNLT
protein accession :
NP_006565
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
10/10/06
updatetime :
11/15/13 18:29
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
