This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
IMP-3 monoclonal antibody (M01A), clone 3B12
catalog :
H00010643-M01A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3B12
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00010643-M01A
product name :
IMP-3 monoclonal antibody (M01A), clone 3B12
product description :
Mouse monoclonal antibody raised against a full-length recombinant IMP-3.
clone name :
3B12
isotype :
IgM Kappa
gene name :
IGF2BP3
gene alias :
DKFZp686F1078 IMP-3 IMP3 KOC1 VICKZ3
gene description :
insulin-like growth factor 2 mRNA binding protein 3
genbank accession :
BC065269
immunogen :
IMP-3 (AAH65269, 1 a.a. ~ 579 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MNKLYIGNLSENAAPSDLESIFKDAKIPVSGPFLVKTGH
AFVDCPDESWALKAIEALSGKIELHGKPIEVEHSVPKRQ
RIRKLQIRNIPPHLQWEVLDSLLVQYGVVESCEQVNTDS
ETAVVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPD
EMAAQQNPLQQPRGRRGLGQRGSSRQGSPGSVSKQKPCD
LPLRLLVPTQFVGAIIGKEGATIRNITKQTQSKIDVHRK
ENAGAAEKSITILSTPEGTSAACKSILEIMHKEAQDIKF
TEEIPLKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITI
SPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESY
ENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPP
SAMTPPYPQFEQSETETVHLFIPALSVGAIIGKQGQHIK
QLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQG
RIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGG
KTVNELQNLSSAEVVVPRDQTPDENDQVVVKITGHFYAC
QVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK
AFVDCPDESWALKAIEALSGKIELHGKPIEVEHSVPKRQ
RIRKLQIRNIPPHLQWEVLDSLLVQYGVVESCEQVNTDS
ETAVVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPD
EMAAQQNPLQQPRGRRGLGQRGSSRQGSPGSVSKQKPCD
LPLRLLVPTQFVGAIIGKEGATIRNITKQTQSKIDVHRK
ENAGAAEKSITILSTPEGTSAACKSILEIMHKEAQDIKF
TEEIPLKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITI
SPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESY
ENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPP
SAMTPPYPQFEQSETETVHLFIPALSVGAIIGKQGQHIK
QLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQG
RIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGG
KTVNELQNLSSAEVVVPRDQTPDENDQVVVKITGHFYAC
QVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK
protein accession :
AAH65269
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,ELISA
size :
200 uL
autodate :
2008-08-18
updatetime :
2012-01-13 16:42:47
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
