This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
AGR2 monoclonal antibody (M05A), clone 1C9
catalog :
H00010551-M05A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1C9
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00010551-M05A
product name :
AGR2 monoclonal antibody (M05A), clone 1C9
product description :
Mouse monoclonal antibody raised against a full-length recombinant AGR2.
clone name :
1C9
isotype :
IgG2b Kappa
gene name :
AGR2
gene alias :
AG2 GOB-4 HAG-2 XAG-2
gene description :
anterior gradient homolog 2 (Xenopus laevis)
genbank accession :
BC015503
immunogen :
AGR2 (AAH15503.1, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPK
LPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHL
DECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKH
LSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPAD
TALLLDNMKKALKLLKTEL
LPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHL
DECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKH
LSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPAD
TALLLDNMKKALKLLKTEL
protein accession :
AAH15503.1
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ti,ELISA,WB-Re,WB-Tr
size :
200 uL
autodate :
2009-01-05
updatetime :
2012-01-13 16:44:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
