AGR2 monoclonal antibody (M03), clone 1C3 | Abnova H00010551-M03 product information

product summary

company name :

Abnova

product type :

antibody

product name :

AGR2 monoclonal antibody (M03), clone 1C3

catalog :

H00010551-M03

quantity :

100 ug

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

1C3

reactivity :

human, mouse

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation

more info or order :

Abnova product webpage

citations: 9

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry; human; 1:8000; loading ...; tbl 3	Procházková I, Lenco J, Fucikova A, Dresler J, Čápková L, Hrstka R, et al. Targeted proteomics driven verification of biomarker candidates associated with breast cancer aggressiveness. Biochim Biophys Acta Proteins Proteom. 2017;1865:488-498 pubmed publisher
immunocytochemistry; mouse; 1:100; loading ...; fig 6d western blot; mouse; 1:800; loading ...; fig 6c	Shen X, Jia Z, D Alonzo D, Wang X, Bruder E, Emch F, et al. HECTD1 controls the protein level of IQGAP1 to regulate the dynamics of adhesive structures. Cell Commun Signal. 2017;15:2 pubmed publisher
immunoprecipitation; human; fig 1 immunocytochemistry; human; 1:100; fig 2 western blot; human; fig 1	Dong A, Wodziak D, Lowe A. Epidermal growth factor receptor (EGFR) signaling requires a specific endoplasmic reticulum thioredoxin for the post-translational control of receptor presentation to the cell surface. J Biol Chem. 2015;290:8016-27 pubmed publisher
	Darb Esfahani S, Fritzsche F, Kristiansen G, Weichert W, Sehouli J, Braicu I, et al. Anterior gradient protein 2 (AGR2) is an independent prognostic factor in ovarian high-grade serous carcinoma. Virchows Arch. 2012;461:109-16 pubmed publisher
	Wayner E, Quek S, Ahmad R, Ho M, Loprieno M, Zhou Y, et al. Development of an ELISA to detect the secreted prostate cancer biomarker AGR2 in voided urine. Prostate. 2012;72:1023-34 pubmed publisher
	Lepreux S, Bioulac Sage P, Chevet E. Differential expression of the anterior gradient protein-2 is a conserved feature during morphogenesis and carcinogenesis of the biliary tree. Liver Int. 2011;31:322-8 pubmed publisher
	Maslon M, Hrstka R, Vojtesek B, Hupp T. A divergent substrate-binding loop within the pro-oncogenic protein anterior gradient-2 forms a docking site for Reptin. J Mol Biol. 2010;404:418-38 pubmed publisher
	Ambolet Camoit A, Bui L, Pierre S, Chevallier A, Marchand A, Coumoul X, et al. 2,3,7,8-tetrachlorodibenzo-p-dioxin counteracts the p53 response to a genotoxicant by upregulating expression of the metastasis marker agr2 in the hepatocarcinoma cell line HepG2. Toxicol Sci. 2010;115:501-12 pubmed publisher
	Zhao L, Lee B, Brown D, Molloy M, Marx G, Pavlakis N, et al. Identification of candidate biomarkers of therapeutic response to docetaxel by proteomic profiling. Cancer Res. 2009;69:7696-703 pubmed publisher

product information

catalog id :

H00010551-M03

product name :

AGR2 monoclonal antibody (M03), clone 1C3

product description :

Mouse monoclonal antibody raised against a full length recombinant AGR2.

clone name :

1C3

isotype :

IgG2b Kappa

gene name :

AGR2

gene alias :

AG2 GOB-4 HAG-2 XAG-2

gene description :

anterior gradient homolog 2 (Xenopus laevis)

genbank accession :

BC015503

immunogen :

AGR2 (AAH15503.1, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

immunogen sequence protein sequence :

MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPK
LPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHL
DECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKH
LSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPAD
TALLLDNMKKALKLLKTEL

protein accession :

AAH15503.1

storage buffer :

In 1x PBS, pH 7.4

storage instruction :

Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing

quality control testing :

Antibody Reactive Against Recombinant Protein

type clonality :

Antibody

raised in host species :

Mouse

antigen species target species :

Human

species reactivity cross reactivity :

Human

application key :

S-ELISA,ELISA,WB-Re,WB-Tr,WB-Ce

size :

100 ug

autodate :

4/30/08

updatetime :

11/15/13 18:40

more info or order :

Abnova product webpage