This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CAP1 monoclonal antibody (M01), clone 4A2
catalog :
H00010487-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4A2
reactivity :
human
application :
western blot, ELISA
citations: 2
| Reference |
|---|
product information
catalog id :
H00010487-M01
product name :
CAP1 monoclonal antibody (M01), clone 4A2
product description :
Mouse monoclonal antibody raised against a full length recombinant CAP1.
clone name :
4A2
isotype :
IgG1 Kappa
gene name :
CAP1
gene alias :
CAP CAP1-PEN
gene description :
CAP, adenylate cyclase-associated protein 1 (yeast)
genbank accession :
BC013963
immunogen :
CAP1 (AAH13963, 1 a.a. ~ 475 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAG
AAPYVQAFDSLLAGPVAEYLKISKEIGGDVQKHAEMVHT
GLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVIT
FREKNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKE
MNDAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQA
YIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSGPPPPP
PGPPPPPVSTSSGSDESASRSALFAQINQGESITHALKH
VSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPK
RATKKEPAVLELEGKKWRVENQENVSNLVIEDTELKQVA
YIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVE
IINSKDVKVQVMGKVPTISINKTDGCHAYLSKNSLDCEI
VSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVT
TVTEIAG
AAPYVQAFDSLLAGPVAEYLKISKEIGGDVQKHAEMVHT
GLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVIT
FREKNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKE
MNDAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQA
YIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSGPPPPP
PGPPPPPVSTSSGSDESASRSALFAQINQGESITHALKH
VSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPK
RATKKEPAVLELEGKKWRVENQENVSNLVIEDTELKQVA
YIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVE
IINSKDVKVQVMGKVPTISINKTDGCHAYLSKNSLDCEI
VSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVT
TVTEIAG
protein accession :
AAH13963
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2006-10-10
updatetime :
2013-11-15 18:29:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
