This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name : 
Abnova
product type : 
antibody
product name : 
GPNMB monoclonal antibody (M01), clone 1A8
catalog : 
H00010457-M01
quantity : 
100 ug
clonality : 
monoclonal
host : 
mouse
conjugate : 
nonconjugated
clone name : 
1A8
reactivity : 
human
application : 
western blot, ELISA
citations: 1
product information
catalog id : 
H00010457-M01
product name : 
GPNMB monoclonal antibody (M01), clone 1A8
product description : 
Mouse monoclonal antibody raised against a partial recombinant GPNMB.
clone name : 
1A8
isotype : 
IgG1 Kappa
gene name : 
GPNMB
gene alias : 
HGFIN NMB
gene description : 
glycoprotein (transmembrane) nmb
genbank accession : 
NM_001005340
immunogen : 
GPNMB (NP_001005340, 104 a.a. ~ 203 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence : 
RCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDS
DGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLG
QYFQKLGRCSVRVSVNTANVTL
DGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLG
QYFQKLGRCSVRVSVNTANVTL
protein accession : 
NP_001005340
storage buffer : 
In 1x PBS, pH 7.4
storage instruction : 
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing : 
Antibody Reactive Against Recombinant Protein
type clonality : 
Antibody
raised in host species : 
Mouse
antigen species target species : 
Human
species reactivity cross reactivity : 
Human
application key : 
S-ELISA,ELISA,WB-Re
size : 
100 ug
autodate : 
2006-11-22
updatetime : 
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St. 
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
