YAP1 monoclonal antibody (M01), clone 2F12 | Abnova H00010413-M01 product information

product summary

company name :

Abnova

product type :

antibody

product name :

YAP1 monoclonal antibody (M01), clone 2F12

catalog :

H00010413-M01

quantity :

100 ug

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

2F12

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Abnova product webpage

citations: 18

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry; mouse; 1:100; loading ...; fig 5a	Korotkevich E, Niwayama R, Courtois A, Friese S, Berger N, Buchholz F, et al. The Apical Domain Is Required and Sufficient for the First Lineage Segregation in the Mouse Embryo. Dev Cell. 2017;40:235-247.e7 pubmed publisher
immunocytochemistry; human; 1:100; loading ...; fig 3a	Lee H, Diaz M, Price K, Ozuna J, Zhang S, Sevick Muraca E, et al. Fluid shear stress activates YAP1 to promote cancer cell motility. Nat Commun. 2017;8:14122 pubmed publisher
immunohistochemistry - frozen section; mouse; 1:60; loading ...; fig s3a western blot; mouse; 1:500; loading ...; fig 3b	Hirai M, Arita Y, McGlade C, Lee K, Chen J, Evans S. Adaptor proteins NUMB and NUMBL promote cell cycle withdrawal by targeting ERBB2 for degradation. J Clin Invest. 2017;127:569-582 pubmed publisher
western blot; rat; 1:400; loading ...; fig 3b western blot; human; 1:400; loading ...; fig 10a	Simile M, Latte G, Demartis M, Brozzetti S, Calvisi D, Porcu A, et al. Post-translational deregulation of YAP1 is genetically controlled in rat liver cancer and determines the fate and stem-like behavior of the human disease. Oncotarget. 2016;7:49194-49216 pubmed publisher
immunoprecipitation; human; loading ...; fig 5d	Yang S, Zhang L, Purohit V, Shukla S, Chen X, Yu F, et al. Active YAP promotes pancreatic cancer cell motility, invasion and tumorigenesis in a mitotic phosphorylation-dependent manner through LPAR3. Oncotarget. 2015;6:36019-31 pubmed publisher
immunoprecipitation; human; fig 1	Yang S, Zhang L, Chen X, Chen Y, Dong J. Oncoprotein YAP regulates the spindle checkpoint activation in a mitotic phosphorylation-dependent manner through up-regulation of BubR1. J Biol Chem. 2015;290:6191-202 pubmed publisher
immunocytochemistry; mouse; 1:100	Shao D, Zhai P, Del Re D, Sciarretta S, Yabuta N, Nojima H, et al. A functional interaction between Hippo-YAP signalling and FoxO1 mediates the oxidative stress response. Nat Commun. 2014;5:3315 pubmed publisher
	Lane B, Heller B, Hollenberg M, Wells C. The RGS-RhoGEFs control the amplitude of YAP1 activation by serum. Sci Rep. 2021;11:2348 pubmed publisher
	Bora Singhal N, Mohankumar D, Saha B, Colin C, Lee J, Martin M, et al. Novel HDAC11 inhibitors suppress lung adenocarcinoma stem cell self-renewal and overcome drug resistance by suppressing Sox2. Sci Rep. 2020;10:4722 pubmed publisher
	Maître J, Turlier H, Illukkumbura R, Eismann B, Niwayama R, Nedelec F, et al. Asymmetric division of contractile domains couples cell positioning and fate specification. Nature. 2016;536:344-348 pubmed publisher
	Yang S, Zhang L, Liu M, Chong R, Ding S, Chen Y, et al. CDK1 phosphorylation of YAP promotes mitotic defects and cell motility and is essential for neoplastic transformation. Cancer Res. 2013;73:6722-33 pubmed publisher
	Hirate Y, Cockburn K, Rossant J, Sasaki H. Tead4 is constitutively nuclear, while nuclear vs. cytoplasmic Yap distribution is regulated in preimplantation mouse embryos. Proc Natl Acad Sci U S A. 2012;109:E3389-90; author reply E3391-2 pubmed publisher
	Skouloudaki K, Walz G. YAP1 recruits c-Abl to protect angiomotin-like 1 from Nedd4-mediated degradation. PLoS ONE. 2012;7:e35735 pubmed publisher
	Wada K, Itoga K, Okano T, Yonemura S, Sasaki H. Hippo pathway regulation by cell morphology and stress fibers. Development. 2011;138:3907-14 pubmed publisher
	Sekido Y. Inactivation of Merlin in malignant mesothelioma cells and the Hippo signaling cascade dysregulation. Pathol Int. 2011;61:331-44 pubmed publisher
	Leivonen S, Rokka A, Östling P, Kohonen P, Corthals G, Kallioniemi O, et al. Identification of miR-193b targets in breast cancer cells and systems biological analysis of their functional impact. Mol Cell Proteomics. 2011;10:M110.005322 pubmed publisher
	Murakami H, Mizuno T, Taniguchi T, Fujii M, Ishiguro F, Fukui T, et al. LATS2 is a tumor suppressor gene of malignant mesothelioma. Cancer Res. 2011;71:873-83 pubmed publisher
	Lau Y, Murray L, Houshmandi S, Xu Y, Gutmann D, Yu Q. Merlin is a potent inhibitor of glioma growth. Cancer Res. 2008;68:5733-42 pubmed publisher

product information

catalog id :

H00010413-M01

product name :

YAP1 monoclonal antibody (M01), clone 2F12

product description :

Mouse monoclonal antibody raised against a partial recombinant YAP1.

clone name :

2F12

isotype :

IgG2a Kappa

gene name :

YAP1

gene alias :

YAP YAP2 YAP65 YKI

gene description :

Yes-associated protein 1, 65kDa

genbank accession :

NM_006106

immunogen :

YAP1 (NP_006097, 53 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

immunogen sequence protein sequence :

QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKL
PDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPA
SLQLGAVSPGTLTPTGVVSGPAATPTAQHLR

protein accession :

NP_006097

storage buffer :

In 1x PBS, pH 7.4

storage instruction :

Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing

quality control testing :

Antibody Reactive Against Recombinant Protein

type clonality :

Antibody

raised in host species :

Mouse

antigen species target species :

Human

species reactivity cross reactivity :

Human,Mouse

application key :

WB-Tr,WB-Ce,ELISA,WB-Re,IF,IHC-P

size :

100 ug

autodate :

10/10/06

updatetime :

11/15/13 18:29

more info or order :

Abnova product webpage