This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
IFITM3 purified MaxPab rabbit polyclonal antibody (D03P)
catalog :
H00010410-D03P
quantity :
100 ug
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot
product information
catalog id :
H00010410-D03P
product name :
IFITM3 purified MaxPab rabbit polyclonal antibody (D03P)
product description :
Rabbit polyclonal antibody raised against a full-length human IFITM3 protein.
gene name :
IFITM3
gene alias :
1-8U IP15
gene description :
interferon induced transmembrane protein 3 (1-8U)
genbank accession :
BC006794
immunogen :
IFITM3 (AAH06794, 1 a.a. ~ 133 a.a) full-length human protein.
immunogen sequence protein sequence :
MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPA
PPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAF
AYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILM
TILLIVIPVLIFQAYG
PPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAF
AYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILM
TILLIVIPVLIFQAYG
protein accession :
AAH06794
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody reactive against mammalian transfected lysate.
type clonality :
Antibody
raised in host species :
Rabbit
antigen species target species :
Human
species reactivity cross reactivity :
Human,Mouse
application key :
WB-Ce,WB-Ti,WB-Tr
size :
100 ug
autodate :
2009-02-23
updatetime :
2013-11-15 18:41:54
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
