This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
KLF2 monoclonal antibody (M09), clone 1D12
catalog :
H00010365-M09
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1D12
reactivity :
human
application :
western blot, ELISA
citations: 1
product information
catalog id :
H00010365-M09
product name :
KLF2 monoclonal antibody (M09), clone 1D12
product description :
Mouse monoclonal antibody raised against a partial recombinant KLF2.
clone name :
1D12
isotype :
IgG2a Kappa
gene name :
KLF2
gene alias :
LKLF
gene description :
Kruppel-like factor 2 (lung)
genbank accession :
NM_016270
immunogen :
KLF2 (NP_057354, 263 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
SWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKP
YHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRA
FSRSDHLALH
YHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRA
FSRSDHLALH
protein accession :
NP_057354
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,ELISA,WB-Re
size :
100 ug
autodate :
2009-07-20
updatetime :
2013-11-15 18:43:32
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
