This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SPRY2 monoclonal antibody (M01), clone 1E10
catalog :
H00010253-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1E10
reactivity :
human
application :
western blot, ELISA, immunocytochemistry, immunohistochemistry - paraffin section
citations: 1
product information
catalog id :
H00010253-M01
product name :
SPRY2 monoclonal antibody (M01), clone 1E10
product description :
Mouse monoclonal antibody raised against a full length recombinant SPRY2.
clone name :
1E10
isotype :
IgG1 Kappa
gene name :
SPRY2
gene alias :
MGC23039 hSPRY2
gene description :
sprouty homolog 2 (Drosophila)
genbank accession :
BC015745
immunogen :
SPRY2 (AAH15745.1, 1 a.a. ~ 315 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MEARAQSGNGSQPLLQTPRDGGRQRGEPDPRDALTQQVH
VLSLDQIRAIRNTNEYTEGPTVVPRPGLKPAPRPSTQHK
HERLHGLPEHRQPPRLQHSQVHSSARAPLSRSISTVSSG
SRSSTRTSTSSSSSEQRLLGSSFSSGPVADGIIRVQPKS
ELKPGELKPLSKEDLGLHAYRCEDCGKCKCKECTYPRPL
PSDWICDKQCLCSAQNVIDYGTCVCCVKGLFYHCSNDDE
DNCADNPCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAK
GCLKLCQGCYDRVNRPGCRCKNSNTVCCKVPTVPPRNFE
KPT
VLSLDQIRAIRNTNEYTEGPTVVPRPGLKPAPRPSTQHK
HERLHGLPEHRQPPRLQHSQVHSSARAPLSRSISTVSSG
SRSSTRTSTSSSSSEQRLLGSSFSSGPVADGIIRVQPKS
ELKPGELKPLSKEDLGLHAYRCEDCGKCKCKECTYPRPL
PSDWICDKQCLCSAQNVIDYGTCVCCVKGLFYHCSNDDE
DNCADNPCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAK
GCLKLCQGCYDRVNRPGCRCKNSNTVCCKVPTVPPRNFE
KPT
protein accession :
AAH15745.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr
size :
100 ug
autodate :
2010-10-08
updatetime :
2013-11-15 18:46:22
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
