This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
TRIM28 monoclonal antibody (M02), clone 1D11
catalog :
H00010155-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1D11
reactivity :
human, mouse, rat
application :
western blot, ELISA, immunohistochemistry - paraffin section
citations: 1
product information
catalog id :
H00010155-M02
product name :
TRIM28 monoclonal antibody (M02), clone 1D11
product description :
Mouse monoclonal antibody raised against a partial recombinant TRIM28.
clone name :
1D11
isotype :
IgG2a Kappa
gene name :
TRIM28
gene alias :
FLJ29029 KAP1 RNF96 TF1B TIF1B
gene description :
tripartite motif-containing 28
genbank accession :
BC004978
immunogen :
TRIM28 (AAH04978, 379 a.a. ~ 524 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
IVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNS
TGPAPMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDD
PYSSAEPHVSGVKRSRSGEGEVSGLMRKVPRVSLERLDL
DLTADSQPPVFKVFPGSTTEDYNLIVIER
TGPAPMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDD
PYSSAEPHVSGVKRSRSGEGEVSGLMRKVPRVSLERLDL
DLTADSQPPVFKVFPGSTTEDYNLIVIER
protein accession :
AAH04978
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Mouse,Rat
application key :
WB-Ce,IHC-P,ELISA,WB-Re,WB-Tr
size :
100 ug
autodate :
2006-10-10
updatetime :
2013-11-15 18:29:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
