This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
AKT3 monoclonal antibody (M04), clone 4C1
catalog :
H00010000-M04
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4C1
reactivity :
human, mouse
application :
western blot, ELISA
product information
catalog id :
H00010000-M04
product name :
AKT3 monoclonal antibody (M04), clone 4C1
product description :
Mouse monoclonal antibody raised against a partial recombinant AKT3.
clone name :
4C1
isotype :
IgG2a Kappa
gene name :
AKT3
gene alias :
DKFZp434N0250 PKB-GAMMA PKBG PRKBG RAC-PK-gamma RAC-gamma STK-2
gene description :
v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)
genbank accession :
AF124141
immunogen :
AKT3 (AAD29089, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
EAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTT
HHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMK
ILKKEVIIAKDE
HHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMK
ILKKEVIIAKDE
protein accession :
AAD29089
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Mouse
application key :
WB-Ce,S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2006-10-10
updatetime :
2013-11-15 18:29:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
