This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
TNFSF15 monoclonal antibody (M09), clone 4F1
catalog :
H00009966-M09
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4F1
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00009966-M09
product name :
TNFSF15 monoclonal antibody (M09), clone 4F1
product description :
Mouse monoclonal antibody raised against a partial recombinant TNFSF15.
clone name :
4F1
isotype :
IgG1 Kappa
gene name :
TNFSF15
gene alias :
MGC129934 MGC129935 TL1 TL1A VEGI VEGI192A
gene description :
tumor necrosis factor (ligand) superfamily, member 15
genbank accession :
BC074941.2
immunogen :
TNFSF15 (AAH74941.1, 72 a.a. ~ 251 a.a) partial recombinant protein.
immunogen sequence protein sequence :
LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHF
KNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFI
YSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSY
PEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLM
VNVSDISLVDYTKEDKTFFGAFLL
KNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFI
YSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSY
PEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLM
VNVSDISLVDYTKEDKTFFGAFLL
protein accession :
AAH74941.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
100 ug
autodate :
2015-08-26
updatetime :
2017-09-05 15:48:47
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
