This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
MFN2 monoclonal antibody (M03J), clone 4H8
catalog :
H00009927-M03J
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
reactivity :
human, rat
application :
western blot, ELISA, immunohistochemistry - paraffin section
product information
catalog id :
H00009927-M03J
product name :
MFN2 monoclonal antibody (M03J), clone 4H8
product description :
Mouse monoclonal antibody raised against a full length recombinant MFN2.
clone name :
4H8
isotype :
IgG2a Kappa
gene name :
MFN2
gene alias :
CMT2A CMT2A2 CPRP1 HSG KIAA0214 MARF
gene description :
mitofusin 2
genbank accession :
NM_014874
immunogen :
MFN2 (NP_055689, 661 a.a. ~ 757 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHL
CQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKA
GWLDSELNMFTHQYLQPSR
CQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKA
GWLDSELNMFTHQYLQPSR
protein accession :
NP_055689
preparation method :
Cell Culture Production. (CX Grade Antibody List)
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Rat
application key :
S-ELISA,RNAi-Ab,IHC-P,WB-Tr,ELISA,WB-Re
size :
100 ug
autodate :
10/27/08
updatetime :
12/12/19 14:00
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
