product summary
Loading...
company name :
Abnova
product type :
antibody
product name :
KIAA0101 monoclonal antibody (M01), clone 3C11-1F11
catalog :
H00009768-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3C11-1F11
reactivity :
human
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 6
| Published Application/Species/Sample/Dilution | Reference |
|---|---|
| |
| |
Yuan R, Jeng Y, Pan H, Hu F, Lai P, Lee P, et al. Overexpression of KIAA0101 predicts high stage, early tumor recurrence, and poor prognosis of hepatocellular carcinoma. Clin Cancer Res. 2007;13:5368-76 pubmed
|
product information
catalog id :
H00009768-M01
product name :
KIAA0101 monoclonal antibody (M01), clone 3C11-1F11
product description :
Mouse monoclonal antibody raised against a full length recombinant KIAA0101.
clone name :
3C11-1F11
isotype :
IgG1 Kappa
gene name :
KIAA0101
gene alias :
L5 NS5ATP9 OEATC-1 OEATC1 PAF p15(PAF)
gene description :
KIAA0101
genbank accession :
BC005832
immunogen :
KIAA0101 (AAH05832, 1 a.a. ~ 111 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVS
SRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEK
ENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
SRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEK
ENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
protein accession :
AAH05832
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re,IF,IHC-P
size :
100 ug
autodate :
11/20/07
updatetime :
11/15/13 18:37
more info or order :
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
related products
browse more products
- RAPGEF5 purified MaxPab mouse polyclonal antibody (B01P) | H00009771-B01P
- RAPGEF5 monoclonal antibody (M09), clone 2E4 | H00009771-M09
- DDX48 polyclonal antibody (A01) | H00009775-A01
- RNF144A purified MaxPab mouse polyclonal antibody (B01P) | H00009781-B01P
- RNF144A purified MaxPab mouse polyclonal antibody (B02P) | H00009781-B02P
questions and comments
