This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CRSP3 monoclonal antibody (M01), clone 4H6
catalog :
H00009439-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
reactivity :
human
product information
catalog id :
H00009439-M01
product name :
CRSP3 monoclonal antibody (M01), clone 4H6
product description :
Mouse monoclonal antibody raised against a partial recombinant CRSP3.
clone name :
4H6
isotype :
IgG2a Kappa
gene name :
MED23
gene alias :
CRSP130 CRSP133 CRSP3 DKFZp434H0117 DRIP130 SUR2
gene description :
mediator complex subunit 23
genbank accession :
NM_004830
immunogen :
CRSP3 (NP_004821, 531 a.a. ~ 630 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
LTVHAKMSLIHSIATRVIKLAHAKSSVALAPALVETYSR
LLVYMEIESLGIKGFISQLLPTVFKSHAWGILHTLLEMF
SYRMHHIQPHYRVQLLSHLHTL
LLVYMEIESLGIKGFISQLLPTVFKSHAWGILHTLLEMF
SYRMHHIQPHYRVQLLSHLHTL
protein accession :
NP_004821
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA
size :
100 ug
autodate :
5/23/08
updatetime :
11/15/13 18:40
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
