This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
NOG monoclonal antibody (M01), clone 4C9
catalog :
H00009241-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4C9
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00009241-M01
product name :
NOG monoclonal antibody (M01), clone 4C9
product description :
Mouse monoclonal antibody raised against a full length recombinant NOG.
clone name :
4C9
isotype :
IgG2b Kappa
gene name :
NOG
gene alias :
SYM1 SYNS1
gene description :
noggin
genbank accession :
BC034027
immunogen :
NOG (AAH34027, 28 a.a. ~ 232 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLL
RSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELD
QLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRK
LQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRS
CSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQY
PIISECKCSC
RSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELD
QLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRK
LQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRS
CSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQY
PIISECKCSC
protein accession :
AAH34027
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
100 ug
autodate :
7/19/07
updatetime :
11/15/13 18:37
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
