This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
RAB11B monoclonal antibody (M03A), clone 2F1
catalog :
H00009230-M03A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2F1
reactivity :
human
product information
catalog id :
H00009230-M03A
product name :
RAB11B monoclonal antibody (M03A), clone 2F1
product description :
Mouse monoclonal antibody raised against a partial recombinant RAB11B.
clone name :
2F1
isotype :
IgM Kappa
gene name :
RAB11B
gene alias :
H-YPT3 MGC133246
gene description :
RAB11B, member RAS oncogene family
genbank accession :
NM_004218
immunogen :
RAB11B (NP_004209, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLE
SKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITS
AYYRGAVGALLVYDIAKHLTYENVERWLKELR
SKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITS
AYYRGAVGALLVYDIAKHLTYENVERWLKELR
protein accession :
NP_004209
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA
size :
200 uL
autodate :
2008-04-16
updatetime :
2012-01-13 16:44:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
