This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
PAMCI monoclonal antibody (M03), clone 2F8
catalog :
H00009182-M03
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
reactivity :
human
product information
catalog id :
H00009182-M03
product name :
PAMCI monoclonal antibody (M03), clone 2F8
product description :
Mouse monoclonal antibody raised against a full-length recombinant PAMCI.
clone name :
2F8
isotype :
IgG2a Kappa
gene name :
RASSF9
gene alias :
P-CIP1 PAMCI
gene description :
Ras association (RalGDS/AF-6) domain family (N-terminal) member 9
genbank accession :
BC031589
immunogen :
PAMCI (AAH31589, 1 a.a. ~ 435 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MAPFGRNLLKTRHKNRSPTKDMDSEEKEIVVWVCQEEKL
VCGLTKRTTSADVIQALLEEHEATFGEKRFLLGKPSDYC
IIEKWRGSERVLPPLTRILKLWKAWGDEQPNMQFVLVKA
DAFLPVPLWRTAEAKLVQNTEKLWELSPANYMKTLPPDK
QKRIVRKTFRKLAKIKQDTVSHDRDNMETLVHLIISQDH
TIHQQVKRMKELDLEIEKCEAKFHLDRVENDGENYVQDA
YLMPSFSEVEQNLDLQYEENQTLEDLSESDGIEQLEERL
KYYRILIDKLSAEIEKEVKSVCIDINEDAEGEAASELES
SNLESVKCDLEKSMKAGLKIHSHLSGIQKEIKYSDSLLQ
MKAKEYELLAKEFNSLHISNKDGCQLKENRAKESEVPSS
NGEIPPFTQRVFSNYTNDTDSDTGISSNHSQDSETTVGD
VVLLST
VCGLTKRTTSADVIQALLEEHEATFGEKRFLLGKPSDYC
IIEKWRGSERVLPPLTRILKLWKAWGDEQPNMQFVLVKA
DAFLPVPLWRTAEAKLVQNTEKLWELSPANYMKTLPPDK
QKRIVRKTFRKLAKIKQDTVSHDRDNMETLVHLIISQDH
TIHQQVKRMKELDLEIEKCEAKFHLDRVENDGENYVQDA
YLMPSFSEVEQNLDLQYEENQTLEDLSESDGIEQLEERL
KYYRILIDKLSAEIEKEVKSVCIDINEDAEGEAASELES
SNLESVKCDLEKSMKAGLKIHSHLSGIQKEIKYSDSLLQ
MKAKEYELLAKEFNSLHISNKDGCQLKENRAKESEVPSS
NGEIPPFTQRVFSNYTNDTDSDTGISSNHSQDSETTVGD
VVLLST
protein accession :
AAH31589
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA
size :
100 ug
autodate :
2008-11-10
updatetime :
2013-11-15 18:40:03
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
