product summary
Loading...
company name :
Abnova
product type :
antibody
product name :
OSMR purified MaxPab mouse polyclonal antibody (B01P)
catalog :
H00009180-B01P
quantity :
50 ug
clonality :
polyclonal
host :
mouse
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunoprecipitation
more info or order :
citations: 2
| Published Application/Species/Sample/Dilution | Reference |
|---|---|
| |
product information
catalog id :
H00009180-B01P
product name :
OSMR purified MaxPab mouse polyclonal antibody (B01P)
product description :
Mouse polyclonal antibody raised against a full-length human OSMR protein.
gene name :
OSMR
gene alias :
MGC150626 MGC150627 MGC75127 OSMRB
gene description :
oncostatin M receptor
genbank accession :
BC010943
immunogen :
OSMR (AAH10943, 1 a.a. ~ 342 a.a) full-length human protein.
immunogen sequence protein sequence :
MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKV
STNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSN
VIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSL
VDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDK
LVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHV
TAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVS
KVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQ
SYTLFESFSGEKKLCTHKNWCNWQITQDSQETYNFTLIA
ENYLRKRSVNILFNLTHRGETRVVTAHRGH
STNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSN
VIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSL
VDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDK
LVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHV
TAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVS
KVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQ
SYTLFESFSGEKKLCTHKNWCNWQITQDSQETYNFTLIA
ENYLRKRSVNILFNLTHRGETRVVTAHRGH
protein accession :
AAH10943
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody reactive against mammalian transfected lysate.
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Tr
size :
50 ug
autodate :
8/5/08
updatetime :
2/5/20 11:36
more info or order :
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
related products
browse more products
questions and comments
