product summary
Loading...
company name :
Abnova
product type :
antibody
product name :
SQSTM1 monoclonal antibody (M01), clone 2C11
catalog :
H00008878-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2C11
reactivity :
human, mouse, rat
application :
western blot, ELISA, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section, immunohistochemistry - free floating section, other
more info or order :
citations: 107
Published Application/Species/Sample/DilutionReference
  • immunocytochemistry; mouse; 1:100; fig 4b
  • western blot; mouse; 1:1000; fig 4a
Arra M, Swarnkar G, Adapala N, Naqvi S, Cai L, Rai M, et al. Glutamine metabolism modulates chondrocyte inflammatory response. elife. 2022;11: pubmed publisher
  • other; mouse; loading ...; fig 6m, 7m
Vessey K, Jobling A, Tran M, Wang A, Greferath U, Fletcher E. Treatments targeting autophagy ameliorate the age-related macular degeneration phenotype in mice lacking APOE (apolipoprotein E). Autophagy. 2022;18:2368-2384 pubmed publisher
  • western blot; mouse; loading ...; fig 4b
Sun H, Ni H, McCracken J, Akakpo J, Fulte S, McKeen T, et al. Liver-specific deletion of mechanistic target of rapamycin does not protect against acetaminophen-induced liver injury in mice. Liver Res. 2021;5:79-87 pubmed publisher
  • western blot; mouse; loading ...
Silva Rojas R, Charles A, Djeddi S, Geny B, Laporte J, Böhm J. Pathophysiological Effects of Overactive STIM1 on Murine Muscle Function and Structure. Cells. 2021;10: pubmed publisher
  • immunocytochemistry; rat; 1:500; loading ...; fig s4c
Özkan N, Koppers M, van Soest I, van Harten A, Jurriens D, Liv N, et al. ER - lysosome contacts at a pre-axonal region regulate axonal lysosome availability. Nat Commun. 2021;12:4493 pubmed publisher
  • western blot; mouse; 1:2000; loading ...; fig 8a, 8b, 8c, 8d
Anandhan A, Nguyen N, Syal A, Dreher L, Dodson M, Zhang D, et al. NRF2 Loss Accentuates Parkinsonian Pathology and Behavioral Dysfunction in Human α-Synuclein Overexpressing Mice. Aging Dis. 2021;12:964-982 pubmed publisher
  • western blot; mouse; loading ...; fig 4b
Satoh K, Takemura Y, Satoh M, Ozaki K, Kubota S. Loss of FYCO1 leads to cataract formation. Sci Rep. 2021;11:13771 pubmed publisher
  • western blot; human; 1:1000; loading ...; fig s5a, s5b
  • western blot; mouse; 1:1000; loading ...; fig 4h
Wojnarowicz P, Escolano M, Huang Y, Desai B, Chin Y, Shah R, et al. Anti-tumor effects of an ID antagonist with no observed acquired resistance. NPJ Breast Cancer. 2021;7:58 pubmed publisher
  • immunocytochemistry; mouse; loading ...; fig 2c
  • western blot; mouse; loading ...; fig 2a
Tamargo Gómez I, Martínez García G, Suarez M, Rey V, Fueyo A, Codina Martínez H, et al. ATG4D is the main ATG8 delipidating enzyme in mammalian cells and protects against cerebellar neurodegeneration. Cell Death Differ. 2021;: pubmed publisher
  • immunohistochemistry - free floating section; rat; 1:500; loading ...; fig 3a
De Miranda B, Castro S, Rocha E, Bodle C, Johnson K, Greenamyre J. The industrial solvent trichloroethylene induces LRRK2 kinase activity and dopaminergic neurodegeneration in a rat model of Parkinson's disease. Neurobiol Dis. 2021;153:105312 pubmed publisher
  • western blot; rat; 1:5000; loading ...
Ormeño F, Hormazabal J, Moreno J, Riquelme F, Rios J, Criollo A, et al. Chaperone Mediated Autophagy Degrades TDP-43 Protein and Is Affected by TDP-43 Aggregation. Front Mol Neurosci. 2020;13:19 pubmed publisher
  • western blot; mouse; loading ...; fig 2c
Wang S, Ni H, Chao X, Wang H, Bridges B, Kumer S, et al. Impaired TFEB-mediated lysosomal biogenesis promotes the development of pancreatitis in mice and is associated with human pancreatitis. Autophagy. 2019;15:1954-1969 pubmed publisher
  • western blot; human; loading ...; fig 3b
Merrill N, Schipper J, Karnes J, Kauffman A, Martin K, Mackeigan J. PI3K-C2? knockdown decreases autophagy and maturation of endocytic vesicles. PLoS ONE. 2017;12:e0184909 pubmed publisher
  • western blot; mouse; loading ...; fig 2f
Bartolomeo R, Cinque L, De Leonibus C, Forrester A, Salzano A, Monfregola J, et al. mTORC1 hyperactivation arrests bone growth in lysosomal storage disorders by suppressing autophagy. J Clin Invest. 2017;127:3717-3729 pubmed publisher
  • western blot; mouse; loading ...; fig 2c
Rocchi A, Yamamoto S, Ting T, Fan Y, SADLEIR K, Wang Y, et al. A Becn1 mutation mediates hyperactive autophagic sequestration of amyloid oligomers and improved cognition in Alzheimer's disease. PLoS Genet. 2017;13:e1006962 pubmed publisher
  • western blot; human; loading ...; fig 4f
Potes Y, de Luxán Delgado B, Rodríguez González S, Guimarães M, Solano J, Fernández Fernández M, et al. Overweight in elderly people induces impaired autophagy in skeletal muscle. Free Radic Biol Med. 2017;110:31-41 pubmed publisher
  • western blot; human; loading ...; fig 5b
Zhang Y, Nguyen D, Olzomer E, Poon G, Cole N, Puvanendran A, et al. Rescue of Pink1 Deficiency by Stress-Dependent Activation of Autophagy. Cell Chem Biol. 2017;24:471-480.e4 pubmed publisher
  • western blot; human; 1:5000; loading ...; fig 3d
Cooper H, Yang Y, Ylikallio E, Khairullin R, Woldegebriel R, Lin K, et al. ATPase-deficient mitochondrial inner membrane protein ATAD3A disturbs mitochondrial dynamics in dominant hereditary spastic paraplegia. Hum Mol Genet. 2017;26:1432-1443 pubmed publisher
  • western blot; mouse; 1:2000; loading ...; fig 2A
Redmann M, Wani W, Volpicelli Daley L, Darley Usmar V, Zhang J. Trehalose does not improve neuronal survival on exposure to alpha-synuclein pre-formed fibrils. Redox Biol. 2017;11:429-437 pubmed publisher
  • western blot; human; loading ...; fig 5j
  • western blot; mouse; loading ...; fig 5a
Pietrocola F, Demont Y, Castoldi F, Enot D, Durand S, Semeraro M, et al. Metabolic effects of fasting on human and mouse blood in vivo. Autophagy. 2017;13:567-578 pubmed publisher
  • western blot; mouse; 1:1000; loading ...; fig 4a
Sambri I, D Alessio R, Ezhova Y, Giuliano T, Sorrentino N, Cacace V, et al. Lysosomal dysfunction disrupts presynaptic maintenance and restoration of presynaptic function prevents neurodegeneration in lysosomal storage diseases. EMBO Mol Med. 2017;9:112-132 pubmed publisher
  • western blot; mouse; loading ...; fig s10b
Newberry E, Xie Y, Kennedy S, Graham M, Crooke R, Jiang H, et al. Prevention of hepatic fibrosis with liver microsomal triglyceride transfer protein deletion in liver fatty acid binding protein null mice. Hepatology. 2017;65:836-852 pubmed publisher
  • western blot; mouse; loading ...; fig 3f
Fan Y, Wang N, Rocchi A, Zhang W, Vassar R, Zhou Y, et al. Identification of natural products with neuronal and metabolic benefits through autophagy induction. Autophagy. 2017;13:41-56 pubmed publisher
  • western blot; mouse; loading ...; fig 8a
Conlon D, Thomas T, Fedotova T, Hernandez Ono A, Di Paolo G, Chan R, et al. Inhibition of apolipoprotein B synthesis stimulates endoplasmic reticulum autophagy that prevents steatosis. J Clin Invest. 2016;126:3852-3867 pubmed publisher
  • western blot; human; fig 3
Kuramoto K, Wang N, Fan Y, Zhang W, Schoenen F, Frankowski K, et al. Autophagy activation by novel inducers prevents BECN2-mediated drug tolerance to cannabinoids. Autophagy. 2016;12:1460-71 pubmed publisher
  • western blot; mouse; 1:2000; fig 2
Seiferling D, Szczepanowska K, Becker C, Senft K, Hermans S, Maiti P, et al. Loss of CLPP alleviates mitochondrial cardiomyopathy without affecting the mammalian UPRmt. EMBO Rep. 2016;17:953-64 pubmed publisher
  • western blot; mouse; fig s1
Korwitz A, Merkwirth C, Richter Dennerlein R, Tröder S, Sprenger H, Quirós P, et al. Loss of OMA1 delays neurodegeneration by preventing stress-induced OPA1 processing in mitochondria. J Cell Biol. 2016;212:157-66 pubmed publisher
  • other; human; fig 4
Puvirajesinghe T, Bertucci F, Jain A, Scerbo P, Belotti E, Audebert S, et al. Identification of p62/SQSTM1 as a component of non-canonical Wnt VANGL2-JNK signalling in breast cancer. Nat Commun. 2016;7:10318 pubmed publisher
  • immunohistochemistry - paraffin section; mouse; fig s13
  • immunocytochemistry; mouse; fig s1
  • western blot; mouse; 1:3000; fig s4
Nemazanyy I, Montagnac G, Russell R, Morzyglod L, Burnol A, Guan K, et al. Class III PI3K regulates organismal glucose homeostasis by providing negative feedback on hepatic insulin signalling. Nat Commun. 2015;6:8283 pubmed publisher
  • western blot; human; fig 7g
Nezich C, Wang C, Fogel A, Youle R. MiT/TFE transcription factors are activated during mitophagy downstream of Parkin and Atg5. J Cell Biol. 2015;210:435-50 pubmed publisher
  • western blot; human; fig 2
Hermanova I, Arruabarrena Aristorena A, Valis K, Nůsková H, Alberich Jorda M, Fiser K, et al. Pharmacological inhibition of fatty-acid oxidation synergistically enhances the effect of l-asparaginase in childhood ALL cells. Leukemia. 2016;30:209-18 pubmed publisher
  • western blot; human; fig 7
Shi Y, Tan S, Ng S, Zhou J, Yang N, Koo G, et al. Critical role of CAV1/caveolin-1 in cell stress responses in human breast cancer cells via modulation of lysosomal function and autophagy. Autophagy. 2015;11:769-84 pubmed publisher
  • immunohistochemistry - paraffin section; human; 1:500
Porta S, Kwong L, Trojanowski J, Lee V. Drosha inclusions are new components of dipeptide-repeat protein aggregates in FTLD-TDP and ALS C9orf72 expansion cases. J Neuropathol Exp Neurol. 2015;74:380-7 pubmed publisher
  • western blot; human; 1:5000; fig 1
  • western blot; mouse; 1:5000; fig 2
Pedro J, Wei Y, Sica V, Maiuri M, Zou Z, Kroemer G, et al. BAX and BAK1 are dispensable for ABT-737-induced dissociation of the BCL2-BECN1 complex and autophagy. Autophagy. 2015;11:452-9 pubmed publisher
  • immunohistochemistry - frozen section; mouse; 1:200
  • western blot; mouse
Ni H, Bhakta A, Wang S, Li Z, Manley S, Huang H, et al. Role of hypoxia inducing factor-1β in alcohol-induced autophagy, steatosis and liver injury in mice. PLoS ONE. 2014;9:e115849 pubmed publisher
  • western blot; mouse
Manley S, Ni H, Williams J, Kong B, DiTacchio L, Guo G, et al. Farnesoid X receptor regulates forkhead Box O3a activation in ethanol-induced autophagy and hepatotoxicity. Redox Biol. 2014;2:991-1002 pubmed publisher
  • western blot; mouse; fig 8
Liang N, Zhang C, Dill P, Panasyuk G, Pion D, Koka V, et al. Regulation of YAP by mTOR and autophagy reveals a therapeutic target of tuberous sclerosis complex. J Exp Med. 2014;211:2249-63 pubmed publisher
  • western blot; mouse
Barnard R, Wittenburg L, Amaravadi R, Gustafson D, Thorburn A, Thamm D. Phase I clinical trial and pharmacodynamic evaluation of combination hydroxychloroquine and doxorubicin treatment in pet dogs treated for spontaneously occurring lymphoma. Autophagy. 2014;10:1415-25 pubmed publisher
  • immunocytochemistry; human; 1:100
Karanasios E, Stapleton E, Manifava M, Ktistakis N. Imaging autophagy. Curr Protoc Cytom. 2014;69:12.34.1-12.34.16 pubmed publisher
  • western blot; human; 1:5000
Mancias J, Wang X, Gygi S, Harper J, Kimmelman A. Quantitative proteomics identifies NCOA4 as the cargo receptor mediating ferritinophagy. Nature. 2014;509:105-9 pubmed publisher
  • western blot; mouse
de Luxán Delgado B, Caballero B, Potes Y, Rubio González A, Rodríguez I, Gutiérrez Rodríguez J, et al. Melatonin administration decreases adipogenesis in the liver of ob/ob mice through autophagy modulation. J Pineal Res. 2014;56:126-33 pubmed publisher
  • western blot; mouse
Ni H, Du K, You M, Ding W. Critical role of FoxO3a in alcohol-induced autophagy and hepatotoxicity. Am J Pathol. 2013;183:1815-1825 pubmed publisher
Demirbag Sarikaya S, Akkoç Y, Turgut S, Erbil Bilir S, Kocaturk N, Dengjel J, et al. A novel ATG5 interaction with Ku70 potentiates DNA repair upon genotoxic stress. Sci Rep. 2022;12:8134 pubmed publisher
Mu Y, Maharjan Y, Kumar Dutta R, Wei X, Kim J, Son J, et al. Pharmacological inhibition of catalase induces peroxisome leakage and suppression of LPS induced inflammatory response in Raw 264.7 cell. PLoS ONE. 2021;16:e0245799 pubmed publisher
Wang B, Maxwell B, Joo J, Gwon Y, Messing J, Mishra A, et al. ULK1 and ULK2 Regulate Stress Granule Disassembly Through Phosphorylation and Activation of VCP/p97. Mol Cell. 2019;74:742-757.e8 pubmed publisher
Vargas J, Wang C, Bunker E, Hao L, Maric D, Schiavo G, et al. Spatiotemporal Control of ULK1 Activation by NDP52 and TBK1 during Selective Autophagy. Mol Cell. 2019;74:347-362.e6 pubmed publisher
Janssen A, Katrukha E, van Straaten W, Verlhac P, Reggiori F, Kapitein L. Probing aggrephagy using chemically-induced protein aggregates. Nat Commun. 2018;9:4245 pubmed publisher
Corona Velazquez A, Corona A, Klein K, Jackson W. Poliovirus induces autophagic signaling independent of the ULK1 complex. Autophagy. 2018;14:1201-1213 pubmed publisher
Henderson M, Peng C, Trojanowski J, Lee V. LRRK2 activity does not dramatically alter α-synuclein pathology in primary neurons. Acta Neuropathol Commun. 2018;6:45 pubmed publisher
Li Y, Chao X, Yang L, Lu Q, Li T, Ding W, et al. Impaired Fasting-Induced Adaptive Lipid Droplet Biogenesis in Liver-Specific Atg5-Deficient Mouse Liver Is Mediated by Persistent Nuclear Factor-Like 2 Activation. Am J Pathol. 2018;188:1833-1846 pubmed publisher
Brewer R, Collins H, Berry R, Brahma M, Tirado B, Peliciari Garcia R, et al. Temporal partitioning of adaptive responses of the murine heart to fasting. Life Sci. 2018;197:30-39 pubmed publisher
Baron O, Boudi A, Dias C, Schilling M, Nölle A, Vizcay Barrena G, et al. Stall in Canonical Autophagy-Lysosome Pathways Prompts Nucleophagy-Based Nuclear Breakdown in Neurodegeneration. Curr Biol. 2017;27:3626-3642.e6 pubmed publisher
Liu S, Jiang Y, Ballou L, Zong W, Lin R. Activation of Gαq in Cardiomyocytes Increases Vps34 Activity and Stimulates Autophagy. J Cardiovasc Pharmacol. 2017;69:198-211 pubmed publisher
Redmann M, Benavides G, Berryhill T, Wani W, Ouyang X, Johnson M, et al. Inhibition of autophagy with bafilomycin and chloroquine decreases mitochondrial quality and bioenergetic function in primary neurons. Redox Biol. 2017;11:73-81 pubmed publisher
Jin H, Hong S, Park J, Chang Y, Hong Y, Park I, et al. Inhibition of JNK-mediated autophagy enhances NSCLC cell sensitivity to mTORC1/2 inhibitors. Sci Rep. 2016;6:28945 pubmed publisher
Dou Z, Xu C, Donahue G, Shimi T, Pan J, Zhu J, et al. Autophagy mediates degradation of nuclear lamina. Nature. 2015;527:105-9 pubmed publisher
Lapash Daniels C, Paffenroth E, Austin E, Glebov K, Lewis D, Walter J, et al. Lithium Decreases Glial Fibrillary Acidic Protein in a Mouse Model of Alexander Disease. PLoS ONE. 2015;10:e0138132 pubmed publisher
Yang H, Peng Y, Ni H, Li Y, Shi Y, Ding W, et al. Basal Autophagy and Feedback Activation of Akt Are Associated with Resistance to Metformin-Induced Inhibition of Hepatic Tumor Cell Growth. PLoS ONE. 2015;10:e0130953 pubmed publisher
Li P, Shi J, He Q, Hu Q, Wang Y, Zhang L, et al. Streptococcus pneumoniae induces autophagy through the inhibition of the PI3K-I/Akt/mTOR pathway and ROS hypergeneration in A549 cells. PLoS ONE. 2015;10:e0122753 pubmed publisher
Morgan M, Gamez G, Menke C, Hernandez A, Thorburn J, Gidan F, et al. Regulation of autophagy and chloroquine sensitivity by oncogenic RAS in vitro is context-dependent. Autophagy. 2014;10:1814-26 pubmed publisher
Chang M, Patel V, Gwede M, Morgado M, Tomasevich K, Fong E, et al. IL-1? induces p62/SQSTM1 and represses androgen receptor expression in prostate cancer cells. J Cell Biochem. 2014;115:2188-97 pubmed publisher
B chir W, Chaveroux C, Carraro V, Averous J, Maurin A, Jousse C, et al. Dual role for CHOP in the crosstalk between autophagy and apoptosis to determine cell fate in response to amino acid deprivation. Cell Signal. 2014;26:1385-91 pubmed publisher
Macvicar T, Lane J. Impaired OMA1-dependent cleavage of OPA1 and reduced DRP1 fission activity combine to prevent mitophagy in cells that are dependent on oxidative phosphorylation. J Cell Sci. 2014;127:2313-25 pubmed publisher
Manley S, Ni H, Kong B, Apte U, Guo G, Ding W. Suppression of autophagic flux by bile acids in hepatocytes. Toxicol Sci. 2014;137:478-90 pubmed publisher
Mizielinska S, Lashley T, Norona F, Clayton E, Ridler C, Fratta P, et al. C9orf72 frontotemporal lobar degeneration is characterised by frequent neuronal sense and antisense RNA foci. Acta Neuropathol. 2013;126:845-57 pubmed publisher
Jang B, Choi B, Kim J, Kim M, Sohn M, Suh S. Impairment of autophagic flux promotes glucose reperfusion-induced neuro2A cell death after glucose deprivation. PLoS ONE. 2013;8:e76466 pubmed publisher
Chang M, Morgado M, Warren C, Hinton C, Farach Carson M, DELK N. p62/SQSTM1 is required for cell survival of apoptosis-resistant bone metastatic prostate cancer cell lines. Prostate. 2014;74:149-63 pubmed publisher
Tardif N, Klaude M, Lundell L, Thorell A, Rooyackers O. Autophagic-lysosomal pathway is the main proteolytic system modified in the skeletal muscle of esophageal cancer patients. Am J Clin Nutr. 2013;98:1485-92 pubmed publisher
B chir W, Maurin A, Carraro V, Averous J, Jousse C, Muranishi Y, et al. The eIF2?/ATF4 pathway is essential for stress-induced autophagy gene expression. Nucleic Acids Res. 2013;41:7683-99 pubmed publisher
Cabrera S, Fernández A, Mariño G, Aguirre A, Suarez M, Español Y, et al. ATG4B/autophagin-1 regulates intestinal homeostasis and protects mice from experimental colitis. Autophagy. 2013;9:1188-200 pubmed publisher
Betin V, Singleton B, Parsons S, Anstee D, Lane J. Autophagy facilitates organelle clearance during differentiation of human erythroblasts: evidence for a role for ATG4 paralogs during autophagosome maturation. Autophagy. 2013;9:881-93 pubmed publisher
Joubert R, Vignaud A, Le M, Moal C, Messaddeq N, Buj Bello A. Site-specific Mtm1 mutagenesis by an AAV-Cre vector reveals that myotubularin is essential in adult muscle. Hum Mol Genet. 2013;22:1856-66 pubmed publisher
Pan J, Fan Y, Gandhirajan R, Madesh M, Zong W. Hyperactivation of the mammalian degenerin MDEG promotes caspase-8 activation and apoptosis. J Biol Chem. 2013;288:2952-63 pubmed publisher
Fetalvero K, Yu Y, Goetschkes M, Liang G, Valdez R, Gould T, et al. Defective autophagy and mTORC1 signaling in myotubularin null mice. Mol Cell Biol. 2013;33:98-110 pubmed publisher
Zhang Y, Yang N, Zhou F, Shen T, Duan T, Zhou J, et al. (-)-Epigallocatechin-3-gallate induces non-apoptotic cell death in human cancer cells via ROS-mediated lysosomal membrane permeabilization. PLoS ONE. 2012;7:e46749 pubmed publisher
Liao C, Ho M, Liang S, Liang C. Recombinant protein rVP1 upregulates BECN1-independent autophagy, MAPK1/3 phosphorylation and MMP9 activity via WIPI1/WIPI2 to promote macrophage migration. Autophagy. 2013;9:5-19 pubmed publisher
Vandergaast R, Fredericksen B. West Nile virus (WNV) replication is independent of autophagy in mammalian cells. PLoS ONE. 2012;7:e45800 pubmed publisher
Williams J, Thomas A, Li G, Kong B, Zhan L, Inaba Y, et al. Tissue specific induction of p62/Sqstm1 by farnesoid X receptor. PLoS ONE. 2012;7:e43961 pubmed publisher
Kharaziha P, De Raeve H, Fristedt C, Li Q, Gruber A, Johnsson P, et al. Sorafenib has potent antitumor activity against multiple myeloma in vitro, ex vivo, and in vivo in the 5T33MM mouse model. Cancer Res. 2012;72:5348-62 pubmed publisher
Lai A, McLaurin J. Inhibition of amyloid-beta peptide aggregation rescues the autophagic deficits in the TgCRND8 mouse model of Alzheimer disease. Biochim Biophys Acta. 2012;1822:1629-37 pubmed publisher
Hagemann T, Jobe E, Messing A. Genetic ablation of Nrf2/antioxidant response pathway in Alexander disease mice reduces hippocampal gliosis but does not impact survival. PLoS ONE. 2012;7:e37304 pubmed publisher
Marchbank K, Waters S, Roberts R, Solomon E, Whitehouse C. MAP1B Interaction with the FW Domain of the Autophagic Receptor Nbr1 Facilitates Its Association to the Microtubule Network. Int J Cell Biol. 2012;2012:208014 pubmed publisher
Ni H, Boggess N, McGill M, Lebofsky M, Borude P, Apte U, et al. Liver-specific loss of Atg5 causes persistent activation of Nrf2 and protects against acetaminophen-induced liver injury. Toxicol Sci. 2012;127:438-50 pubmed publisher
Menon S, Yecies J, Zhang H, Howell J, Nicholatos J, Harputlugil E, et al. Chronic activation of mTOR complex 1 is sufficient to cause hepatocellular carcinoma in mice. Sci Signal. 2012;5:ra24 pubmed publisher
Durieux A, Vassilopoulos S, Laine J, Fraysse B, Brinas L, Prudhon B, et al. A centronuclear myopathy--dynamin 2 mutation impairs autophagy in mice. Traffic. 2012;13:869-79 pubmed publisher
Ghazi Noori S, Froud K, Mizielinska S, Powell C, Smidak M, Fernández de Marco M, et al. Progressive neuronal inclusion formation and axonal degeneration in CHMP2B mutant transgenic mice. Brain. 2012;135:819-32 pubmed publisher
Jaber N, Dou Z, Chen J, Catanzaro J, Jiang Y, Ballou L, et al. Class III PI3K Vps34 plays an essential role in autophagy and in heart and liver function. Proc Natl Acad Sci U S A. 2012;109:2003-8 pubmed publisher
Kharaziha P, Rodriguez P, Li Q, Rundqvist H, Björklund A, Augsten M, et al. Targeting of distinct signaling cascades and cancer-associated fibroblasts define the efficacy of Sorafenib against prostate cancer cells. Cell Death Dis. 2012;3:e262 pubmed publisher
Chen J, Xavier S, Moskowitz Kassai E, Chen R, Lu C, Sanduski K, et al. Cathepsin cleavage of sirtuin 1 in endothelial progenitor cells mediates stress-induced premature senescence. Am J Pathol. 2012;180:973-83 pubmed publisher
Krüger U, Wang Y, Kumar S, Mandelkow E. Autophagic degradation of tau in primary neurons and its enhancement by trehalose. Neurobiol Aging. 2012;33:2291-305 pubmed publisher
Zois C, Giatromanolaki A, Sivridis E, Papaiakovou M, Kainulainen H, Koukourakis M. "Autophagic flux" in normal mouse tissues: focus on endogenous LC3A processing. Autophagy. 2011;7:1371-8 pubmed publisher
Deng H, Chen W, Hong S, Boycott K, Gorrie G, Siddique N, et al. Mutations in UBQLN2 cause dominant X-linked juvenile and adult-onset ALS and ALS/dementia. Nature. 2011;477:211-5 pubmed publisher
Levy J, Thorburn A. Modulation of pediatric brain tumor autophagy and chemosensitivity. J Neurooncol. 2012;106:281-90 pubmed publisher
Ng S, Wu Y, Chen B, Zhou J, Shen H. Impaired autophagy due to constitutive mTOR activation sensitizes TSC2-null cells to cell death under stress. Autophagy. 2011;7:1173-86 pubmed publisher
Kovacs J, Li C, Yang Q, Li G, Garcia I, Ju S, et al. Autophagy promotes T-cell survival through degradation of proteins of the cell death machinery. Cell Death Differ. 2012;19:144-52 pubmed publisher
Yang S, Wang X, Contino G, Liesa M, Sahin E, Ying H, et al. Pancreatic cancers require autophagy for tumor growth. Genes Dev. 2011;25:717-29 pubmed publisher
Zois C, Giatromanolaki A, Kainulainen H, Botaitis S, Torvinen S, Simopoulos C, et al. Lung autophagic response following exposure of mice to whole body irradiation, with and without amifostine. Biochem Biophys Res Commun. 2011;404:552-8 pubmed publisher
Whitehouse C, Waters S, Marchbank K, Horner A, McGowan N, Jovanovic J, et al. Neighbor of Brca1 gene (Nbr1) functions as a negative regulator of postnatal osteoblastic bone formation and p38 MAPK activity. Proc Natl Acad Sci U S A. 2010;107:12913-8 pubmed publisher
Deng H, Zhai H, Bigio E, Yan J, Fecto F, Ajroud K, et al. FUS-immunoreactive inclusions are a common feature in sporadic and non-SOD1 familial amyotrophic lateral sclerosis. Ann Neurol. 2010;67:739-48 pubmed publisher
Wang B, Ling S, Lin W. 14-3-3Tau regulates Beclin 1 and is required for autophagy. PLoS ONE. 2010;5:e10409 pubmed publisher
Lee H, Mattei L, Steinberg B, Alberts P, Lee Y, Chervonsky A, et al. In vivo requirement for Atg5 in antigen presentation by dendritic cells. Immunity. 2010;32:227-39 pubmed publisher
Wu Y, Tan H, Shui G, Bauvy C, Huang Q, Wenk M, et al. Dual role of 3-methyladenine in modulation of autophagy via different temporal patterns of inhibition on class I and III phosphoinositide 3-kinase. J Biol Chem. 2010;285:10850-61 pubmed publisher
Mardakheh F, Yekezare M, Machesky L, Heath J. Spred2 interaction with the late endosomal protein NBR1 down-regulates fibroblast growth factor receptor signaling. J Cell Biol. 2009;187:265-77 pubmed publisher
Ferguson C, Lenk G, Meisler M. Defective autophagy in neurons and astrocytes from mice deficient in PI(3,5)P2. Hum Mol Genet. 2009;18:4868-78 pubmed publisher
Gal J, Strom A, Kwinter D, Kilty R, Zhang J, Shi P, et al. Sequestosome 1/p62 links familial ALS mutant SOD1 to LC3 via an ubiquitin-independent mechanism. J Neurochem. 2009;111:1062-73 pubmed publisher
Bjørkøy G, Lamark T, Pankiv S, Øvervatn A, Brech A, Johansen T. Monitoring autophagic degradation of p62/SQSTM1. Methods Enzymol. 2009;452:181-97 pubmed publisher
Jung H, Chung K, Won Kim J, Kim J, Komatsu M, Tanaka K, et al. Loss of autophagy diminishes pancreatic beta cell mass and function with resultant hyperglycemia. Cell Metab. 2008;8:318-24 pubmed publisher
product information
catalog id :
H00008878-M01
product name :
SQSTM1 monoclonal antibody (M01), clone 2C11
product description :
Mouse monoclonal antibody raised against a full length recombinant SQSTM1.
clone name :
2C11
isotype :
IgG2a kappa
gene name :
SQSTM1
gene alias :
A170 OSIL PDB3 ZIP3 p60 p62 p62B
gene description :
sequestosome 1
genbank accession :
BC003139
immunogen :
SQSTM1 (AAH03139.1, 1 a.a. ~ 440 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAA
GPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLVAFS
SDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEA
PRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEG
KGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGW
PGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSV
NFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPVSP
ESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMR
KIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTG
ELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEA
DPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALD
TIQYSKHPPPL
protein accession :
AAH03139.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Mouse
application key :
S-ELISA,ELISA,WB-Re,IF
size :
100 ug
autodate :
10/10/06
updatetime :
11/15/13 18:29
more info or order :
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com
877-853-6098