This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
PROM1 monoclonal antibody (M08), clone 2F4
catalog :
H00008842-M08
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2F4
reactivity :
human
product information
catalog id :
H00008842-M08
product name :
PROM1 monoclonal antibody (M08), clone 2F4
product description :
Mouse monoclonal antibody raised against a partial recombinant PROM1.
clone name :
2F4
isotype :
IgG2b Kappa
gene name :
PROM1
gene alias :
AC133 CD133 MSTP061 PROML1 RP41
gene description :
prominin 1
genbank accession :
NM_006017
immunogen :
PROM1 (NP_006008, 693 a.a. ~ 790 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
STLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNT
SSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKP
VATALDTAVDVFLCSYIIDP
SSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKP
VATALDTAVDVFLCSYIIDP
protein accession :
NP_006008
storage buffer :
In 1x PBS, pH 7.2
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA
size :
100 ug
autodate :
2009-04-27
updatetime :
2016-04-27 14:56:29
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
