This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
APOL1 MaxPab rabbit polyclonal antibody (D01)
catalog :
H00008542-D01
quantity :
100 uL
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunoprecipitation
product information
catalog id :
H00008542-D01
product name :
APOL1 MaxPab rabbit polyclonal antibody (D01)
product description :
Rabbit polyclonal antibody raised against a full-length human APOL1 protein.
gene name :
APOL1
gene alias :
APO-L APOL APOL-I
gene description :
apolipoprotein L, 1
genbank accession :
BC017331.1
immunogen :
APOL1 (AAH17331.1, 1 a.a. ~ 238 a.a) full-length human protein.
immunogen sequence protein sequence :
MEGAALLRVSVLCIWMSALFLGVGVRAEEAGARVQQNVP
SGTDTGDPQSKPLGDWAAGTMDPESSIFIEDAIKYFKEK
VSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDN
LARQMIMKDKNWHDKGQQYRNWFLKEFPRLKSELEDNIR
RLRALADGVQKVHKGTTIANVVSGSLSISSGILTLVGMG
LAPFTEGGSLVLLEPGMELGITAALTGITSSTMDYGKKW
WTQA
SGTDTGDPQSKPLGDWAAGTMDPESSIFIEDAIKYFKEK
VSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDN
LARQMIMKDKNWHDKGQQYRNWFLKEFPRLKSELEDNIR
RLRALADGVQKVHKGTTIANVVSGSLSISSGILTLVGMG
LAPFTEGGSLVLLEPGMELGITAALTGITSSTMDYGKKW
WTQA
protein accession :
AAH17331.1
storage buffer :
No additive
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody reactive against mammalian transfected lysate.
type clonality :
Antibody
raised in host species :
Rabbit
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Tr,IP
size :
100 uL
autodate :
2010-03-15
updatetime :
2010-04-16 01:01:47
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
