This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CXCR4 monoclonal antibody (M02A), clone 1F8
catalog :
H00007852-M02A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1F8
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00007852-M02A
product name :
CXCR4 monoclonal antibody (M02A), clone 1F8
product description :
Mouse monoclonal antibody raised against a partial recombinant CXCR4.
clone name :
1F8
isotype :
IgG1 Kappa
gene name :
CXCR4
gene alias :
CD184 D2S201E FB22 HM89 HSY3RR LAP3 LCR1 LESTR NPY3R NPYR NPYRL NPYY3R WHIM
gene description :
chemokine (C-X-C motif) receptor 4
genbank accession :
BC020968
immunogen :
CXCR4 (AAH20968, 1 a.a. ~ 46 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKI
FLPTIYS
FLPTIYS
protein accession :
AAH20968
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ti,ELISA,WB-Re
size :
200 uL
autodate :
2007-03-01
updatetime :
2012-01-13 16:44:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
