This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
TUBA1A monoclonal antibody (M06), clone 2D2
catalog :
H00007846-M06
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2D2
reactivity :
human
application :
western blot, ELISA, immunocytochemistry
product information
catalog id :
H00007846-M06
product name :
TUBA1A monoclonal antibody (M06), clone 2D2
product description :
Mouse monoclonal antibody raised against a partial recombinant TUBA1A.
clone name :
2D2
isotype :
IgG2a Kappa
gene name :
TUBA1A
gene alias :
B-ALPHA-1 FLJ25113 LIS3 TUBA3
gene description :
tubulin, alpha 1a
genbank accession :
NM_006009
immunogen :
TUBA1A (NP_006000, 352 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
KVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWAR
LDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALE
KDYEEVGVDSVEGEGEEEGEEY
LDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALE
KDYEEVGVDSVEGEGEEEGEEY
protein accession :
NP_006000
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,IF,S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2008-05-22
updatetime :
2015-06-09 13:41:04
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
