This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SUMO1 monoclonal antibody (M03), clone 3D7
catalog :
H00007341-M03
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3D7
reactivity :
human
application :
western blot, ELISA, immunocytochemistry, immunohistochemistry - paraffin section
product information
catalog id :
H00007341-M03
product name :
SUMO1 monoclonal antibody (M03), clone 3D7
product description :
Mouse monoclonal antibody raised against a full-length recombinant SUMO1.
clone name :
3D7
isotype :
IgG2a Kappa
gene name :
SUMO1
gene alias :
DAP-1 GMP1 OFC10 PIC1 SENP2 SMT3 SMT3C SMT3H3 SUMO-1 UBL1
gene description :
SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae)
genbank accession :
NM_001005781.1
immunogen :
SUMO1 (NP_001005781.1, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVK
MTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPK
ELGMEEEDVIEVYQEQTGGHSTV
MTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPK
ELGMEEEDVIEVYQEQTGGHSTV
protein accession :
NP_001005781.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr
size :
100 ug
autodate :
2010-07-19
updatetime :
2013-11-15 18:46:22
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
